PDB entry 1rra

View 1rra on RCSB PDB site
Description: ribonuclease a from rattus norvegicus (common rat)
Class: hydrolase
Keywords: hydrolase(phosphoric diester), ribonuclease
Deposited on 1998-12-04, released 1998-12-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.186
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (ribonuclease)
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1rraa_
  • Heterogens: PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rraA (A:)
    aessadkfkrqhmdtegpskssptycnqmmkrqgmtkgsckpvntfvhepledvqaicsq
    gqvtckngrnnchkssstlritdcrlkgsskypncdytttdsqkhiiiacdgnpyvpvhf
    dasv