PDB entry 1rra

View 1rra on RCSB PDB site
Description: ribonuclease a from rattus norvegicus (common rat)
Deposited on 1998-12-04, released 1998-12-09
The last revision prior to the SCOP 1.63 freeze date was dated 1999-12-29, with a file datestamp of 1999-12-28.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.186
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.63: d1rraa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rraA (A:)
    aessadkfkrqhmdtegpskssptycnqmmkrqgmtkgsckpvntfvhepledvqaicsq
    gqvtckngrnnchkssstlritdcrlkgsskypncdytttdsqkhiiiacdgnpyvpvhf
    dasv