PDB entry 1rr9

View 1rr9 on RCSB PDB site
Description: catalytic domain of e.coli lon protease
Deposited on 2003-12-08, released 2003-12-23
The last revision prior to the SCOP 1.71 freeze date was dated 2004-04-06, with a file datestamp of 2004-04-06.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.243
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1rr9a_
  • Chain 'B':
    Domains in SCOP 1.71: d1rr9b_
  • Chain 'C':
    Domains in SCOP 1.71: d1rr9c_
  • Chain 'D':
    Domains in SCOP 1.71: d1rr9d_
  • Chain 'E':
    Domains in SCOP 1.71: d1rr9e_
  • Chain 'F':
    Domains in SCOP 1.71: d1rr9f_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1rr9A (A:)
    dygradnenrvgqvtglawtevggdlltietacvpgkgkltytgslgevmqesiqaaltv
    vraraeklginpdfyekrdihvhvpegatpkdgpaagiamctalvscltgnpvradvamt
    geitlrgqvlpigglkekllaahrggiktvlipfenkrdleeipdnviadldihpvkrie
    evltlalqnepsgmqvvtak
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rr9A (A:)
    rvgqvtglawtevggdlltietacvpgkgkltytgslgevmqesiqaaltvvraraeklg
    inpdfyekrdihvhvpegatpkdgpaagiamctalvscltgnpvradvamtgeitlrgqv
    lpigglkekllaahrggiktvlipfenkrdleeipdnviadldihpvkrieevltlalqn
    ep
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1rr9B (B:)
    dygradnenrvgqvtglawtevggdlltietacvpgkgkltytgslgevmqesiqaaltv
    vraraeklginpdfyekrdihvhvpegatpkdgpaagiamctalvscltgnpvradvamt
    geitlrgqvlpigglkekllaahrggiktvlipfenkrdleeipdnviadldihpvkrie
    evltlalqnepsgmqvvtak
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rr9B (B:)
    rvgqvtglawtevggdlltietacvpgkgkltytgslgevmqesiqaaltvvraraeklg
    inpdfyekrdihvhvpegatpkdgpaagiamctalvscltgnpvradvamtgeitlrgqv
    lpigglkekllaahrggiktvlipfenkrdleeipdnviadldihpvkrieevltlalqn
    ep
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1rr9C (C:)
    dygradnenrvgqvtglawtevggdlltietacvpgkgkltytgslgevmqesiqaaltv
    vraraeklginpdfyekrdihvhvpegatpkdgpaagiamctalvscltgnpvradvamt
    geitlrgqvlpigglkekllaahrggiktvlipfenkrdleeipdnviadldihpvkrie
    evltlalqnepsgmqvvtak
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rr9C (C:)
    rvgqvtglawtevggdlltietacvpgkgkltytgslgevmqesiqaaltvvraraeklg
    inpdfyekrdihvhvpegatpkdgpaagiamctalvscltgnpvradvamtgeitlrgqv
    lpigglkekllaahrggiktvlipfenkrdleeipdnviadldihpvkrieevltlalqn
    ep
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1rr9D (D:)
    dygradnenrvgqvtglawtevggdlltietacvpgkgkltytgslgevmqesiqaaltv
    vraraeklginpdfyekrdihvhvpegatpkdgpaagiamctalvscltgnpvradvamt
    geitlrgqvlpigglkekllaahrggiktvlipfenkrdleeipdnviadldihpvkrie
    evltlalqnepsgmqvvtak
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rr9D (D:)
    rvgqvtglawtevggdlltietacvpgkgkltytgslgevmqesiqaaltvvraraeklg
    inpdfyekrdihvhvpegatpkdgpaagiamctalvscltgnpvradvamtgeitlrgqv
    lpigglkekllaahrggiktvlipfenkrdleeipdnviadldihpvkrieevltlalqn
    ep
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1rr9E (E:)
    dygradnenrvgqvtglawtevggdlltietacvpgkgkltytgslgevmqesiqaaltv
    vraraeklginpdfyekrdihvhvpegatpkdgpaagiamctalvscltgnpvradvamt
    geitlrgqvlpigglkekllaahrggiktvlipfenkrdleeipdnviadldihpvkrie
    evltlalqnepsgmqvvtak
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rr9E (E:)
    rvgqvtglawtevggdlltietacvpgkgkltytgslgevmqesiqaaltvvraraeklg
    inpdfyekrdihvhvpegatpkdgpaagiamctalvscltgnpvradvamtgeitlrgqv
    lpigglkekllaahrggiktvlipfenkrdleeipdnviadldihpvkrieevltlalqn
    epsgmqvvtak
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1rr9F (F:)
    dygradnenrvgqvtglawtevggdlltietacvpgkgkltytgslgevmqesiqaaltv
    vraraeklginpdfyekrdihvhvpegatpkdgpaagiamctalvscltgnpvradvamt
    geitlrgqvlpigglkekllaahrggiktvlipfenkrdleeipdnviadldihpvkrie
    evltlalqnepsgmqvvtak
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rr9F (F:)
    nrvgqvtglawtevggdlltietacvpgkgkltytgslgevmqesiqaaltvvraraekl
    ginpdfyekrdihvhvpegatpkdgpaagiamctalvscltgnpvradvamtgeitlrgq
    vlpigglkekllaahrggiktvlipfenkrdleeipdnviadldihpvkrieevltlalq
    ne