PDB entry 1rr8

View 1rr8 on RCSB PDB site
Description: Structural Mechanisms of Camptothecin Resistance by Mutations in Human Topoisomerase I
Class: isomerase/DNA
Keywords: Protein-DNA complex, Topotecan, Camptothecin, Nucleic Acid, Human Topoisomerase I
Deposited on 2003-12-08, released 2004-07-06
The last revision prior to the SCOP 1.73 freeze date was dated 2004-07-06, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.242
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 5'-d(*ap*ap*ap*ap*ap*gp*ap*cp*tp*t*gp*gp*ap*ap*ap*ap*ap*tp*tp*tp*tp*t)-3'
  • Chain 'B':
    Compound: 5'-d(*ap*ap*ap*ap*ap*tp*tp*tp*tp*tp*cp*cp*ap*ap*gp*tp*cp*tp*tp*tp*tp*t)-3'
  • Chain 'C':
    Compound: DNA topoisomerase I
    Species: HOMO SAPIENS
    Gene: TOP1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P11387 (2-564)
      • cloning artifact (0-1)
      • engineered (160)
      • engineered (433)
      • modified residue (522)
    Domains in SCOP 1.73: d1rr8c1, d1rr8c2
  • Heterogens: TTG, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1rr8C (C:)
    aawkwweeerypegikwkflehkgpvfappyeplpenvkfyydgkvmklspkaeevatff
    akmldheyttkeifrknffkdwrkemtneekniitnlskcdftqmsqyfkaqtearkqms
    keeklkikeenekllkeygfcimdnhkerianfkieppglsrgrgnhpkmgmlkrrimpe
    diiincskdakvpspppghkwkevrhdnkvtwlvswteniqgsikyimlnpssrikgekd
    wqkyetarrlkkcvdkirnqyredwkskemkvrqravalyfidklalragnekeegetad
    tvgccslrvehinlhpeldgqeyvvefdflgkdsiryynkvpvekrvfknlqlfmenkqp
    eddlfdrlntgilnkhlqdlmegltakvfrtynasitlqqqlkeltapdenipakilsyn
    ranravailcnhqqappktfeksmmnlqtkidakkeqladarrdlksakadakvmkdakt
    kkvveskkkavqrleeqlmklevqatdreenkqialgtsklnyldpritvawckkwgvpi
    ekiynktqrekfawaidmadedyef
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rr8C (C:)
    aawkwweeerypegikwkflehkgpvfappyeplpenvkfyydgkvmklspkaeevatff
    akmldheyttkeifrknffkdwrkemtneekniitnlskcdftqmsqyfkaqtearkqms
    keeklkikeenekllkeygfcimdnhkerianfkieppglsrgrgnhpkmgmlkrrimpe
    diiincskdakvpspppghkwkevrhdnkvtwlvswteniqgsikyimlnpssrikgekd
    wqkyetarrlkkcvdkirnqyredwkskemkvrqravalyfidklalragnekeegetad
    tvgccslrvehinlhpeldgqeyvvefdflgkdsiryynkvpvekrvfknlqlfmenkqp
    eddlfdrlntgilnkhlqdlmegltakvfrtynasitlqqqlkeltapdenipakilsyn
    ranravailcnhqqapreenkqialgtsklnyldpritvawckkwgvpiekiynktqrek
    fawaidmadedyef