PDB entry 1rqw

View 1rqw on RCSB PDB site
Description: thaumatin structure at 1.05 a resolution
Deposited on 2003-12-07, released 2003-12-23
The last revision prior to the SCOP 1.67 freeze date was dated 2003-12-23, with a file datestamp of 2003-12-23.
Experiment type: XRAY
Resolution: 1.05 Å
R-factor: 0.127
AEROSPACI score: 0.96 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1rqwa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rqwA (A:)
    atfeivnrcsytvwaaaskgdaaldaggrqlnsgeswtinvepgtkggkiwartdcyfdd
    sgsgicktgdcggllrckrfgrppttlaefslnqygkdyidisnikgfnvpmdfspttrg
    crgvrcaadivgqcpaklkapgggcndactvfqtseyccttgkcgpteysrffkrlcpda
    fsyvldkpttvtcpgssnyrvtfcpta