PDB entry 1rqv

View 1rqv on RCSB PDB site
Description: Spatial model of L7 dimer from E.coli with one hinge region in helical state
Class: ribosome
Keywords: protein L7/L12,ribosome, NMR
Deposited on 2003-12-07, released 2004-03-02
The last revision prior to the SCOP 1.73 freeze date was dated 2005-03-08, with a file datestamp of 2007-06-04.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 50S ribosomal protein L7/L12
    Species: Escherichia coli
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1rqva1, d1rqva2
  • Chain 'B':
    Compound: 50S ribosomal protein L7/L12
    Species: Escherichia coli
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1rqvb1, d1rqvb2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1rqvA (A:)
sitkdqiieavaamsvmdvvelisameekfgvsaaaavavaagpveaaeektefdvilka
agankvavikavrgatglglkeakdlvesapaalkegvskddaealkkaleeagaevevk

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1rqvB (B:)
sitkdqiieavaamsvmdvvelisameekfgvsaaaavavaagpveaaeektefdvilka
agankvavikavrgatglglkeakdlvesapaalkegvskddaealkkaleeagaevevk