PDB entry 1rqu
View 1rqu on RCSB PDB site
Description: NMR structure of L7 dimer from E.coli
Class: ribosome
Keywords: protein L7/L12, ribosome, NMR
Deposited on
2003-12-07, released
2004-03-02
The last revision prior to the SCOP 1.75 freeze date was dated
2005-03-08, with a file datestamp of
2007-06-04.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: 50S ribosomal protein L7/L12
Species: Escherichia coli
Database cross-references and differences (RAF-indexed):
Domains in SCOP 1.75: d1rqua1, d1rqua2 - Chain 'B':
Compound: 50S ribosomal protein L7/L12
Species: Escherichia coli
Database cross-references and differences (RAF-indexed):
Domains in SCOP 1.75: d1rqub1, d1rqub2
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>1rquA (A:)
sitkdqiieavaamsvmdvvelisameekfgvsaaaavavaagpveaaeektefdvilka
agankvavikavrgatglglkeakdlvesapaalkegvskddaealkkaleeagaevevk
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>1rquB (B:)
sitkdqiieavaamsvmdvvelisameekfgvsaaaavavaagpveaaeektefdvilka
agankvavikavrgatglglkeakdlvesapaalkegvskddaealkkaleeagaevevk