PDB entry 1rqt

View 1rqt on RCSB PDB site
Description: NMR structure of dimeric N-terminal domain of ribosomal protein L7 from E.coli
Class: ribosome
Keywords: protein L7/L12,ribosome, NMR
Deposited on 2003-12-07, released 2004-03-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 50S ribosomal protein L7/L12
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1rqta_
  • Chain 'B':
    Compound: 50S ribosomal protein L7/L12
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1rqtb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rqtA (A:)
    sitkdqiieavaamsvmdvvelisameekfgvsaaaa
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rqtB (B:)
    sitkdqiieavaamsvmdvvelisameekfgvsaaaa