PDB entry 1rqq

View 1rqq on RCSB PDB site
Description: Crystal Structure of the Insulin Receptor Kinase in Complex with the SH2 Domain of APS
Class: transferase/signaling protein
Keywords: Protein tyrosine kinase, adaptor protein, SH2 domain, TRANSFERASE/SIGNALING PROTEIN COMPLEX
Deposited on 2003-12-06, released 2003-12-30
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.229
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Insulin receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: INSR
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06213 (Start-305)
      • modified residue (180)
      • modified residue (184-185)
      • natural variant (273)
    Domains in SCOPe 2.05: d1rqqa_
  • Chain 'B':
    Compound: Insulin receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: INSR
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06213 (Start-305)
      • modified residue (180)
      • modified residue (184-185)
      • natural variant (273)
    Domains in SCOPe 2.05: d1rqqb_
  • Chain 'C':
    Compound: adaptor protein APS
    Species: Rattus norvegicus [TaxId:10116]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1rqqc_
  • Chain 'D':
    Compound: adaptor protein APS
    Species: Rattus norvegicus [TaxId:10116]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1rqqd_
  • Chain 'E':
    Compound: bisubstrate inhibitor
    Species:
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 1RQQ
  • Chain 'F':
    Compound: bisubstrate inhibitor
    Species:
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 1RQQ
  • Heterogens: MN, 112, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1rqqA (A:)
    vfpssvyvpdewevsrekitllrelgqgsfgmvyegnardiikgeaetrvavktvnesas
    lrerieflneasvmkgftchhvvrllgvvskgqptlvvmelmahgdlksylrslrpeaen
    npgrppptlqemiqmaaeiadgmaylnakkfvhrdlaarncmvahdftvkigdfgmtrdi
    yetdyyrkggkgllpvrwmapeslkdgvfttssdmwsfgvvlweitslaeqpyqglsneq
    vlkfvmdggyldqpdncpervtdlmrmcwqfnpnmrptfleivnllkddlhpsfpevsff
    hseenk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rqqA (A:)
    dewevsrekitllrelgqgsfgmvyegnardiikgeaetrvavktvnesaslreriefln
    easvmkgftchhvvrllgvvskgqptlvvmelmahgdlksylrslrpeaennpgrppptl
    qemiqmaaeiadgmaylnakkfvhrdlaarncmvahdftvkigdfgmtrdiyetdyyrkg
    gkgllpvrwmapeslkdgvfttssdmwsfgvvlweitslaeqpyqglsneqvlkfvmdgg
    yldqpdncpervtdlmrmcwqfnpnmrptfleivnllkddlhpsfpevsffhseenk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1rqqB (B:)
    vfpssvyvpdewevsrekitllrelgqgsfgmvyegnardiikgeaetrvavktvnesas
    lrerieflneasvmkgftchhvvrllgvvskgqptlvvmelmahgdlksylrslrpeaen
    npgrppptlqemiqmaaeiadgmaylnakkfvhrdlaarncmvahdftvkigdfgmtrdi
    yetdyyrkggkgllpvrwmapeslkdgvfttssdmwsfgvvlweitslaeqpyqglsneq
    vlkfvmdggyldqpdncpervtdlmrmcwqfnpnmrptfleivnllkddlhpsfpevsff
    hseenk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rqqB (B:)
    dewevsrekitllrelgqgsfgmvyegnardiikgeaetrvavktvnesaslreriefln
    easvmkgftchhvvrllgvvskgqptlvvmelmahgdlksylrslrpeaennpgrppptl
    qemiqmaaeiadgmaylnakkfvhrdlaarncmvahdftvkigdfgmtrdiyetdyyrkg
    gkgllpvrwmapeslkdgvfttssdmwsfgvvlweitslaeqpyqglsneqvlkfvmdgg
    yldqpdncpervtdlmrmcwqfnpnmrptfleivnllkddlhpsfpevsffhseenk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1rqqC (C:)
    gshmelelsdypwfhgtlsrvkaaqlvlaggprshglfvirqsetrpgecvltfnfqgka
    khlrlslnghgqchvqhlwfqsvfdmlrhfhthpiplesggsaditlrsyvraq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rqqC (C:)
    lelsdypwfhgtlsrvkaaqlvlaggprshglfvirqsetrpgecvltfnfqgkakhlrl
    slngqchvqhlwfqsvfdmlrhf
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1rqqD (D:)
    gshmelelsdypwfhgtlsrvkaaqlvlaggprshglfvirqsetrpgecvltfnfqgka
    khlrlslnghgqchvqhlwfqsvfdmlrhfhthpiplesggsaditlrsyvraq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rqqD (D:)
    lelsdypwfhgtlsrvkaaqlvlaggprshglfvirqsetrpgecvltfnfqgkakhlrl
    slngqchvqhlwfqsvfdmlrhf
    

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.