PDB entry 1rqq

View 1rqq on RCSB PDB site
Description: Crystal Structure of the Insulin Receptor Kinase in Complex with the SH2 Domain of APS
Deposited on 2003-12-06, released 2003-12-30
The last revision prior to the SCOP 1.67 freeze date was dated 2003-12-30, with a file datestamp of 2003-12-30.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.229
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1rqqa_
  • Chain 'B':
    Domains in SCOP 1.67: d1rqqb_
  • Chain 'C':
    Domains in SCOP 1.67: d1rqqc_
  • Chain 'D':
    Domains in SCOP 1.67: d1rqqd_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1rqqA (A:)
    vfpssvyvpdewevsrekitllrelgqgsfgmvyegnardiikgeaetrvavktvnesas
    lrerieflneasvmkgftchhvvrllgvvskgqptlvvmelmahgdlksylrslrpeaen
    npgrppptlqemiqmaaeiadgmaylnakkfvhrdlaarncmvahdftvkigdfgmtrdi
    yetdyyrkggkgllpvrwmapeslkdgvfttssdmwsfgvvlweitslaeqpyqglsneq
    vlkfvmdggyldqpdncpervtdlmrmcwqfnpnmrptfleivnllkddlhpsfpevsff
    hseenk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rqqA (A:)
    dewevsrekitllrelgqgsfgmvyegnardiikgeaetrvavktvnesaslreriefln
    easvmkgftchhvvrllgvvskgqptlvvmelmahgdlksylrslrpeaennpgrppptl
    qemiqmaaeiadgmaylnakkfvhrdlaarncmvahdftvkigdfgmtrdiyetdyyrkg
    gkgllpvrwmapeslkdgvfttssdmwsfgvvlweitslaeqpyqglsneqvlkfvmdgg
    yldqpdncpervtdlmrmcwqfnpnmrptfleivnllkddlhpsfpevsffhseenk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1rqqB (B:)
    vfpssvyvpdewevsrekitllrelgqgsfgmvyegnardiikgeaetrvavktvnesas
    lrerieflneasvmkgftchhvvrllgvvskgqptlvvmelmahgdlksylrslrpeaen
    npgrppptlqemiqmaaeiadgmaylnakkfvhrdlaarncmvahdftvkigdfgmtrdi
    yetdyyrkggkgllpvrwmapeslkdgvfttssdmwsfgvvlweitslaeqpyqglsneq
    vlkfvmdggyldqpdncpervtdlmrmcwqfnpnmrptfleivnllkddlhpsfpevsff
    hseenk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rqqB (B:)
    dewevsrekitllrelgqgsfgmvyegnardiikgeaetrvavktvnesaslreriefln
    easvmkgftchhvvrllgvvskgqptlvvmelmahgdlksylrslrpeaennpgrppptl
    qemiqmaaeiadgmaylnakkfvhrdlaarncmvahdftvkigdfgmtrdiyetdyyrkg
    gkgllpvrwmapeslkdgvfttssdmwsfgvvlweitslaeqpyqglsneqvlkfvmdgg
    yldqpdncpervtdlmrmcwqfnpnmrptfleivnllkddlhpsfpevsffhseenk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1rqqC (C:)
    gshmelelsdypwfhgtlsrvkaaqlvlaggprshglfvirqsetrpgecvltfnfqgka
    khlrlslnghgqchvqhlwfqsvfdmlrhfhthpiplesggsaditlrsyvraq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rqqC (C:)
    lelsdypwfhgtlsrvkaaqlvlaggprshglfvirqsetrpgecvltfnfqgkakhlrl
    slngqchvqhlwfqsvfdmlrhf
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1rqqD (D:)
    gshmelelsdypwfhgtlsrvkaaqlvlaggprshglfvirqsetrpgecvltfnfqgka
    khlrlslnghgqchvqhlwfqsvfdmlrhfhthpiplesggsaditlrsyvraq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rqqD (D:)
    lelsdypwfhgtlsrvkaaqlvlaggprshglfvirqsetrpgecvltfnfqgkakhlrl
    slngqchvqhlwfqsvfdmlrhf