PDB entry 1rqp

View 1rqp on RCSB PDB site
Description: Crystal structure and mechanism of a bacterial fluorinating enzyme
Class: transferase
Keywords: fluorinase, central 7 stranded beta sheets, anti-parallel beta sheets, TRANSFERASE
Deposited on 2003-12-06, released 2004-03-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.17
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 5'-fluoro-5'-deoxyadenosine synthase
    Species: Streptomyces cattleya [TaxId:29303]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1rqpa1, d1rqpa2
  • Chain 'B':
    Compound: 5'-fluoro-5'-deoxyadenosine synthase
    Species: Streptomyces cattleya [TaxId:29303]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1rqpb1, d1rqpb2
  • Chain 'C':
    Compound: 5'-fluoro-5'-deoxyadenosine synthase
    Species: Streptomyces cattleya [TaxId:29303]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1rqpc1, d1rqpc2
  • Heterogens: SAM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1rqpA (A:)
    maanstrrpiiafmsdlgttddsvaqckglmysicpdvtvvdvchsmtpwdveegaryiv
    dlprffpegtvfatttypatgtttrsvavrikqaakggargqwagsgagferaegsyiyi
    apnngllttvleehgyleayevtspkvipeqpeptfysremvaipsahlaagfplsevgr
    pledheivrfnrpaveqdgealvgvvsaidhpfgnvwtnihrtdlekagigygarlrltl
    dgvlpfeapltptfadageigniaiylnsrgylsiarnaaslaypyhlkegmsarvear
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rqpA (A:)
    rpiiafmsdlgttddsvaqckglmysicpdvtvvdvchsmtpwdveegaryivdlprffp
    egtvfatttypatgtttrsvavrikqaakggargqwagsgagferaegsyiyiapnngll
    ttvleehgyleayevtspkvipeqpeptfysremvaipsahlaagfplsevgrpledhei
    vrfnrpaveqdgealvgvvsaidhpfgnvwtnihrtdlekagigygarlrltldgvlpfe
    apltptfadageigniaiylnsrgylsiarnaaslaypyhlkegmsarvea
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1rqpB (B:)
    maanstrrpiiafmsdlgttddsvaqckglmysicpdvtvvdvchsmtpwdveegaryiv
    dlprffpegtvfatttypatgtttrsvavrikqaakggargqwagsgagferaegsyiyi
    apnngllttvleehgyleayevtspkvipeqpeptfysremvaipsahlaagfplsevgr
    pledheivrfnrpaveqdgealvgvvsaidhpfgnvwtnihrtdlekagigygarlrltl
    dgvlpfeapltptfadageigniaiylnsrgylsiarnaaslaypyhlkegmsarvear
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rqpB (B:)
    rpiiafmsdlgttddsvaqckglmysicpdvtvvdvchsmtpwdveegaryivdlprffp
    egtvfatttypatgtttrsvavrikqaakggargqwagsgagferaegsyiyiapnngll
    ttvleehgyleayevtspkvipeqpeptfysremvaipsahlaagfplsevgrpledhei
    vrfnrpaveqdgealvgvvsaidhpfgnvwtnihrtdlekagigygarlrltldgvlpfe
    apltptfadageigniaiylnsrgylsiarnaaslaypyhlkegmsarvea
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1rqpC (C:)
    maanstrrpiiafmsdlgttddsvaqckglmysicpdvtvvdvchsmtpwdveegaryiv
    dlprffpegtvfatttypatgtttrsvavrikqaakggargqwagsgagferaegsyiyi
    apnngllttvleehgyleayevtspkvipeqpeptfysremvaipsahlaagfplsevgr
    pledheivrfnrpaveqdgealvgvvsaidhpfgnvwtnihrtdlekagigygarlrltl
    dgvlpfeapltptfadageigniaiylnsrgylsiarnaaslaypyhlkegmsarvear
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rqpC (C:)
    rpiiafmsdlgttddsvaqckglmysicpdvtvvdvchsmtpwdveegaryivdlprffp
    egtvfatttypatgtttrsvavrikqaakggargqwagsgagferaegsyiyiapnngll
    ttvleehgyleayevtspkvipeqpeptfysremvaipsahlaagfplsevgrpledhei
    vrfnrpaveqdgealvgvvsaidhpfgnvwtnihrtdlekagigygarlrltldgvlpfe
    apltptfadageigniaiylnsrgylsiarnaaslaypyhlkegmsarvea