PDB entry 1rqj

View 1rqj on RCSB PDB site
Description: Active Conformation of Farnesyl Pyrophosphate Synthase Bound to Isopentyl Pyrophosphate and Risedronate
Class: transferase
Keywords: bisphosphonate, isoprenyl synthase, TRANSFERASE
Deposited on 2003-12-05, released 2004-03-02
The last revision prior to the SCOPe 2.04 freeze date was dated 2013-05-22, with a file datestamp of 2013-05-17.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.207
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Geranyltranstransferase
    Species: Escherichia coli [TaxId:562]
    Gene: ISPA, B0421
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1rqja_
  • Chain 'B':
    Compound: Geranyltranstransferase
    Species: Escherichia coli [TaxId:562]
    Gene: ISPA, B0421
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1rqjb_
  • Heterogens: MG, IPE, RIS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rqjA (A:)
    mdfpqqleacvkqanqalsrfiaplpfqntpvvetmqygallggkrlrpflvyatghmfg
    vstntldapaaavecihayslihddlpamddddlrrglptchvkfgeanailagdalqtl
    afsilsdadmpevsdrdrismiselasasgiagmcggqaldldaegkhvpldalerihrh
    ktgaliraavrlgalsagdkgrralpvldkyaesiglafqvqddildvvgdtatlgkrqg
    adqqlgkstypallgleqarkkardliddarqslkqlaeqsldtsalealadyiiqrnk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1rqjB (B:)
    mdfpqqleacvkqanqalsrfiaplpfqntpvvetmqygallggkrlrpflvyatghmfg
    vstntldapaaavecihayslihddlpamddddlrrglptchvkfgeanailagdalqtl
    afsilsdadmpevsdrdrismiselasasgiagmcggqaldldaegkhvpldalerihrh
    ktgaliraavrlgalsagdkgrralpvldkyaesiglafqvqddildvvgdtatlgkrqg
    adqqlgkstypallgleqarkkardliddarqslkqlaeqsldtsalealadyiiqrnk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rqjB (B:)
    dfpqqleacvkqanqalsrfiaplpfqntpvvetmqygallggkrlrpflvyatghmfgv
    stntldapaaavecihayslihddlpamddddlrrglptchvkfgeanailagdalqtla
    fsilsdadmpevsdrdrismiselasasgiagmcggqaldldaegkhvpldalerihrhk
    tgaliraavrlgalsagdkgrralpvldkyaesiglafqvqddildvvgdtatlgkrqga
    dqqlgkstypallgleqarkkardliddarqslkqlaeqsldtsalealadyiiqrnk