PDB entry 1rqi

View 1rqi on RCSB PDB site
Description: Active Conformation of Farnesyl Pyrophosphate Synthase Bound to Isopentyl Pyrophosphate and Dimethylallyl S-Thiolodiphosphate
Class: transferase
Keywords: isoprenyl synthase, TRANSFERASE
Deposited on 2003-12-05, released 2004-03-02
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.42 Å
R-factor: 0.206
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Geranyltranstransferase
    Species: Escherichia coli [TaxId:562]
    Gene: ISPA, B0421
    Database cross-references and differences (RAF-indexed):
    • Uniprot P22939 (1-299)
      • cloning artifact (0)
    Domains in SCOPe 2.04: d1rqia_
  • Chain 'B':
    Compound: Geranyltranstransferase
    Species: Escherichia coli [TaxId:562]
    Gene: ISPA, B0421
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1rqib_
  • Heterogens: MG, DST, IPR, DPO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rqiA (A:)
    amdfpqqleacvkqanqalsrfiaplpfqntpvvetmqygallggkrlrpflvyatghmf
    gvstntldapaaavecihayslihddlpamddddlrrglptchvkfgeanailagdalqt
    lafsilsdadmpevsdrdrismiselasasgiagmcggqaldldaegkhvpldalerihr
    hktgaliraavrlgalsagdkgrralpvldkyaesiglafqvqddildvvgdtatlgkrq
    gadqqlgkstypallgleqarkkardliddarqslkqlaeqsldtsalealadyiiqrnk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1rqiB (B:)
    amdfpqqleacvkqanqalsrfiaplpfqntpvvetmqygallggkrlrpflvyatghmf
    gvstntldapaaavecihayslihddlpamddddlrrglptchvkfgeanailagdalqt
    lafsilsdadmpevsdrdrismiselasasgiagmcggqaldldaegkhvpldalerihr
    hktgaliraavrlgalsagdkgrralpvldkyaesiglafqvqddildvvgdtatlgkrq
    gadqqlgkstypallgleqarkkardliddarqslkqlaeqsldtsalealadyiiqrnk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rqiB (B:)
    dfpqqleacvkqanqalsrfiaplpfqntpvvetmqygallggkrlrpflvyatghmfgv
    stntldapaaavecihayslihddlpamddddlrrglptchvkfgeanailagdalqtla
    fsilsdadmpevsdrdrismiselasasgiagmcggqaldldaegkhvpldalerihrhk
    tgaliraavrlgalsagdkgrralpvldkyaesiglafqvqddildvvgdtatlgkrqga
    dqqlgkstypallgleqarkkardliddarqslkqlaeqsldtsalealadyiiqrnk