PDB entry 1rqc

View 1rqc on RCSB PDB site
Description: Crystals of peptide deformylase from Plasmodium falciparum with ten subunits per asymmetric unit reveal critical characteristics of the active site for drug design
Class: hydrolase
Keywords: hydrolase
Deposited on 2003-12-04, released 2004-01-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.225
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: formylmethionine deformylase
    Species: Plasmodium falciparum [TaxId:5833]
    Gene: PDF
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8I372 (Start-176)
      • modified residue (33)
      • modified residue (37)
      • modified residue (149)
      • expression tag (177-180)
    Domains in SCOPe 2.07: d1rqca1, d1rqca2
  • Chain 'B':
    Compound: formylmethionine deformylase
    Species: Plasmodium falciparum [TaxId:5833]
    Gene: PDF
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8I372 (Start-176)
      • modified residue (33)
      • modified residue (37)
      • modified residue (149)
      • expression tag (177-180)
    Domains in SCOPe 2.07: d1rqcb1, d1rqcb2
  • Chain 'C':
    Compound: formylmethionine deformylase
    Species: Plasmodium falciparum [TaxId:5833]
    Gene: PDF
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8I372
      • modified residue (33)
      • modified residue (37)
      • modified residue (149)
    Domains in SCOPe 2.07: d1rqcc_
  • Chain 'D':
    Compound: formylmethionine deformylase
    Species: Plasmodium falciparum [TaxId:5833]
    Gene: PDF
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8I372
      • modified residue (33)
      • modified residue (37)
      • modified residue (149)
    Domains in SCOPe 2.07: d1rqcd_
  • Chain 'E':
    Compound: formylmethionine deformylase
    Species: Plasmodium falciparum [TaxId:5833]
    Gene: PDF
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8I372 (Start-176)
      • modified residue (33)
      • modified residue (37)
      • modified residue (149)
      • expression tag (177)
    Domains in SCOPe 2.07: d1rqce1, d1rqce2
  • Chain 'F':
    Compound: formylmethionine deformylase
    Species: Plasmodium falciparum [TaxId:5833]
    Gene: PDF
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8I372
      • modified residue (33)
      • modified residue (37)
      • modified residue (149)
    Domains in SCOPe 2.07: d1rqcf_
  • Chain 'G':
    Compound: formylmethionine deformylase
    Species: Plasmodium falciparum [TaxId:5833]
    Gene: PDF
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8I372
      • modified residue (33)
      • modified residue (37)
      • modified residue (149)
    Domains in SCOPe 2.07: d1rqcg_
  • Chain 'H':
    Compound: formylmethionine deformylase
    Species: Plasmodium falciparum [TaxId:5833]
    Gene: PDF
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8I372
      • modified residue (33)
      • modified residue (37)
      • modified residue (149)
    Domains in SCOPe 2.07: d1rqch_
  • Chain 'I':
    Compound: formylmethionine deformylase
    Species: Plasmodium falciparum [TaxId:5833]
    Gene: PDF
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8I372
      • modified residue (33)
      • modified residue (37)
      • modified residue (149)
    Domains in SCOPe 2.07: d1rqci_
  • Chain 'J':
    Compound: formylmethionine deformylase
    Species: Plasmodium falciparum [TaxId:5833]
    Gene: PDF
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8I372
      • modified residue (33)
      • modified residue (37)
      • modified residue (149)
    Domains in SCOPe 2.07: d1rqcj_
  • Heterogens: CO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1rqcA (A:)
    deikivkypdpilrrrseevtnfddnlkrvvrkmfdimyeskgiglsapqvniskriivw
    nalyekrkeenerifinpsiveqslvklkliegclsfpgiegkverpsivsisyydingy
    khlkilkgihsrifqhefdhlngtlfidkmtqvdkkkvrpklnelirdykathseepleh
    hhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rqcA (A:)
    kivkypdpilrrrseevtnfddnlkrvvrkmfdimyeskgiglsapqvniskriivwnal
    yekrkeenerifinpsiveqslvklkliegclsfpgiegkverpsivsisyydingykhl
    kilkgihsrifqhefdhlngtlfidkmtqvdkkkvrpklnelirdykathseeplehh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1rqcB (B:)
    deikivkypdpilrrrseevtnfddnlkrvvrkmfdimyeskgiglsapqvniskriivw
    nalyekrkeenerifinpsiveqslvklkliegclsfpgiegkverpsivsisyydingy
    khlkilkgihsrifqhefdhlngtlfidkmtqvdkkkvrpklnelirdykathseepleh
    hhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rqcB (B:)
    kivkypdpilrrrseevtnfddnlkrvvrkmfdimyeskgiglsapqvniskriivwnal
    yekrkeenerifinpsiveqslvklkliegclsfpgiegkverpsivsisyydingykhl
    kilkgihsrifqhefdhlngtlfidkmtqvdkkkvrpklnelirdykathseeplehh
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1rqcC (C:)
    deikivkypdpilrrrseevtnfddnlkrvvrkmfdimyeskgiglsapqvniskriivw
    nalyekrkeenerifinpsiveqslvklkliegclsfpgiegkverpsivsisyydingy
    khlkilkgihsrifqhefdhlngtlfidkmtqvdkkkvrpklnelirdykathseepleh
    hhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rqcC (C:)
    kivkypdpilrrrseevtnfddnlkrvvrkmfdimyeskgiglsapqvniskriivwnal
    yekrkeenerifinpsiveqslvklkliegclsfpgiegkverpsivsisyydingykhl
    kilkgihsrifqhefdhlngtlfidkmtqvdkkkvrpklnelirdyka
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1rqcD (D:)
    deikivkypdpilrrrseevtnfddnlkrvvrkmfdimyeskgiglsapqvniskriivw
    nalyekrkeenerifinpsiveqslvklkliegclsfpgiegkverpsivsisyydingy
    khlkilkgihsrifqhefdhlngtlfidkmtqvdkkkvrpklnelirdykathseepleh
    hhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rqcD (D:)
    kivkypdpilrrrseevtnfddnlkrvvrkmfdimyeskgiglsapqvniskriivwnal
    yekrkeenerifinpsiveqslvklkliegclsfpgiegkverpsivsisyydingykhl
    kilkgihsrifqhefdhlngtlfidkmtqvdkkkvrpklnelirdykathsee
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1rqcE (E:)
    deikivkypdpilrrrseevtnfddnlkrvvrkmfdimyeskgiglsapqvniskriivw
    nalyekrkeenerifinpsiveqslvklkliegclsfpgiegkverpsivsisyydingy
    khlkilkgihsrifqhefdhlngtlfidkmtqvdkkkvrpklnelirdykathseepleh
    hhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rqcE (E:)
    kivkypdpilrrrseevtnfddnlkrvvrkmfdimyeskgiglsapqvniskriivwnal
    yekrkeenerifinpsiveqslvklkliegclsfpgiegkverpsivsisyydingykhl
    kilkgihsrifqhefdhlngtlfidkmtqvdkkkvrpklnelirdykathseepl
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1rqcF (F:)
    deikivkypdpilrrrseevtnfddnlkrvvrkmfdimyeskgiglsapqvniskriivw
    nalyekrkeenerifinpsiveqslvklkliegclsfpgiegkverpsivsisyydingy
    khlkilkgihsrifqhefdhlngtlfidkmtqvdkkkvrpklnelirdykathseepleh
    hhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rqcF (F:)
    kivkypdpilrrrseevtnfddnlkrvvrkmfdimyeskgiglsapqvniskriivwnal
    yekrkeenerifinpsiveqslvklkliegclsfpgiegkverpsivsisyydingykhl
    kilkgihsrifqhefdhlngtlfidkmtqvdkkkvrpklnelirdykathse
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1rqcG (G:)
    deikivkypdpilrrrseevtnfddnlkrvvrkmfdimyeskgiglsapqvniskriivw
    nalyekrkeenerifinpsiveqslvklkliegclsfpgiegkverpsivsisyydingy
    khlkilkgihsrifqhefdhlngtlfidkmtqvdkkkvrpklnelirdykathseepleh
    hhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rqcG (G:)
    kivkypdpilrrrseevtnfddnlkrvvrkmfdimyeskgiglsapqvniskriivwnal
    yekrkeenerifinpsiveqslvklkliegclsfpgiegkverpsivsisyydingykhl
    kilkgihsrifqhefdhlngtlfidkmtqvdkkkvrpklnelirdykaths
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1rqcH (H:)
    deikivkypdpilrrrseevtnfddnlkrvvrkmfdimyeskgiglsapqvniskriivw
    nalyekrkeenerifinpsiveqslvklkliegclsfpgiegkverpsivsisyydingy
    khlkilkgihsrifqhefdhlngtlfidkmtqvdkkkvrpklnelirdykathseepleh
    hhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rqcH (H:)
    kivkypdpilrrrseevtnfddnlkrvvrkmfdimyeskgiglsapqvniskriivwnal
    yekrkeenerifinpsiveqslvklkliegclsfpgiegkverpsivsisyydingykhl
    kilkgihsrifqhefdhlngtlfidkmtqvdkkkvrpklnelirdykathsee
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >1rqcI (I:)
    deikivkypdpilrrrseevtnfddnlkrvvrkmfdimyeskgiglsapqvniskriivw
    nalyekrkeenerifinpsiveqslvklkliegclsfpgiegkverpsivsisyydingy
    khlkilkgihsrifqhefdhlngtlfidkmtqvdkkkvrpklnelirdykathseepleh
    hhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rqcI (I:)
    kivkypdpilrrrseevtnfddnlkrvvrkmfdimyeskgiglsapqvniskriivwnal
    yekrkeenerifinpsiveqslvklkliegclsfpgiegkverpsivsisyydingykhl
    kilkgihsrifqhefdhlngtlfidkmtqvdkkkvrpklnelirdykaths
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >1rqcJ (J:)
    deikivkypdpilrrrseevtnfddnlkrvvrkmfdimyeskgiglsapqvniskriivw
    nalyekrkeenerifinpsiveqslvklkliegclsfpgiegkverpsivsisyydingy
    khlkilkgihsrifqhefdhlngtlfidkmtqvdkkkvrpklnelirdykathseepleh
    hhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rqcJ (J:)
    kivkypdpilrrrseevtnfddnlkrvvrkmfdimyeskgiglsapqvniskriivwnal
    yekrkeenerifinpsiveqslvklkliegclsfpgiegkverpsivsisyydingykhl
    kilkgihsrifqhefdhlngtlfidkmtqvdkkkvrpklnelirdykaths