PDB entry 1rq9

View 1rq9 on RCSB PDB site
Description: Crystal structures of a Multidrug-Resistant HIV-1 Protease Reveal an Expanded Active Site Cavity
Class: hydrolase
Keywords: HIV protease, AIDS, polyprotein, hydrolase, aspartyl protease, multi-drug resistance
Deposited on 2003-12-04, released 2004-12-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.254
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Protease
  Species: Human immunodeficiency virus 1 [TaxId:11676]
  Gene: HIV-1
  Database cross-references and differences (RAF-indexed):
  • GB AAF05674 (0-98)
    • engineered (24)
    • engineered (35)
    • engineered (83)
  Domains in SCOPe 2.07: d1rq9a_
• Chain 'B':
  Compound: Protease
  Species: Human immunodeficiency virus 1 [TaxId:11676]
  Gene: HIV-1
  Database cross-references and differences (RAF-indexed):
  • GB AAF05674 (0-98)
    • engineered (24)
    • engineered (35)
    • engineered (83)
  Domains in SCOPe 2.07: d1rq9b_
• Heterogens: DMQ, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1rq9A (A:)
  pqitlwqrpivtikiggqlkeallntgaddtvleevnlpgrwkpkliggiggfvkvrqyd
  qvpieicghkvigtvlvgptpanvigrnlmtqigctlnf
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1rq9B (B:)
  pqitlwqrpivtikiggqlkeallntgaddtvleevnlpgrwkpkliggiggfvkvrqyd
  qvpieicghkvigtvlvgptpanvigrnlmtqigctlnf