PDB entry 1rq9

View 1rq9 on RCSB PDB site
Description: crystal structures of a multidrug-resistant hiv-1 protease reveal an expanded active site cavity
Deposited on 2003-12-04, released 2004-12-07
The last revision prior to the SCOP 1.71 freeze date was dated 2004-12-07, with a file datestamp of 2004-12-07.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.254
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1rq9a_
  • Chain 'B':
    Domains in SCOP 1.71: d1rq9b_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1rq9A (A:)
pqitlwqrpivtikiggqlkeallntgaddtvleevnlpgrwkpkliggiggfvkvrqyd
qvpieicghkvigtvlvgptpanvigrnlmtqigctlnf

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1rq9B (B:)
pqitlwqrpivtikiggqlkeallntgaddtvleevnlpgrwkpkliggiggfvkvrqyd
qvpieicghkvigtvlvgptpanvigrnlmtqigctlnf