PDB entry 1rq8

View 1rq8 on RCSB PDB site
Description: Solution structure of the hypothetical protein SAV1595 from Staphylococcus aureus, a putative RNA binding protein
Class: structural genomics, unknown function
Keywords: STRUCTURAL GENOMICS, SAV1595, YhbY, UPF0044, UNKNOWN FUNCTION
Deposited on 2003-12-04, released 2004-07-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: conserved hypothetical protein
    Species: Staphylococcus aureus [TaxId:1280]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1rq8a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1rq8A (A:)
    mltgkqkrylrslahnidpifqigkgginenmikqiddtlenrelikvhvlqnnfddkke
    laetlseatrselvqvigsmiviyreskenkeielplehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rq8A (A:)
    mltgkqkrylrslahnidpifqigkgginenmikqiddtlenrelikvhvlqnnfddkke
    laetlseatrselvqvigsmiviyreskenkeielp