PDB entry 1rq7

View 1rq7 on RCSB PDB site
Description: mycobacterium tuberculosis ftsz in complex with GDP
Class: cell cycle, signaling protein
Keywords: cell cycle, tubulin, gtpase
Deposited on 2003-12-04, released 2004-08-31
The last revision prior to the SCOP 1.73 freeze date was dated 2004-08-31, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.187
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cell division protein ftsz
    Species: Mycobacterium tuberculosis
    Gene: FTSZ, RV2150C, MT2209, MTCY270.18, MB2174C
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1rq7a1, d1rq7a2
  • Chain 'B':
    Compound: cell division protein ftsz
    Species: Mycobacterium tuberculosis
    Gene: FTSZ, RV2150C, MT2209, MTCY270.18, MB2174C
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1rq7b1, d1rq7b2
  • Heterogens: GDP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1rq7A (A:)
    gshmtpphnylavikvvgiggggvnavnrmieqglkgvefiaintdaqallmsdadvkld
    vgrdstrglgagadpevgrkaaedakdeieellrgadmvfvtagegggtgtggapvvasi
    arklgaltvgvvtrpfsfegkrrsnqaengiaalrescdtlivipndrllqmgdaavslm
    dafrsadevllngvqgitdlittpglinvdfadvkgimsgagtalmgigsargegrslka
    aeiainsplleasmegaqgvlmsiaggsdlglfeineaaslvqdaahpdaniifgtvidd
    slgdevrvtviaagfdvsgpgrkpvmgetggahriesakagkltstlfepvdavsvplht
    ngatlsiggddddvdvppfmrr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rq7A (A:)
    lavikvvgiggggvnavnrmieqglkgvefiaintdaqallmsdadvkldvgrdstgadp
    evgrkaaedakdeieellrgadmvfvtagegggtgtggapvvasiarklgaltvgvvtrp
    fsfegkrrsnqaengiaalrescdtlivipndrllqmgdaavslmdafrsadevllngvq
    gitdlittpglinvdfadvkgimsgagtalmgigsargegrslkaaeiainsplleasme
    gaqgvlmsiaggsdlglfeineaaslvqdaahpdaniifgtviddslgdevrvtviaagf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1rq7B (B:)
    gshmtpphnylavikvvgiggggvnavnrmieqglkgvefiaintdaqallmsdadvkld
    vgrdstrglgagadpevgrkaaedakdeieellrgadmvfvtagegggtgtggapvvasi
    arklgaltvgvvtrpfsfegkrrsnqaengiaalrescdtlivipndrllqmgdaavslm
    dafrsadevllngvqgitdlittpglinvdfadvkgimsgagtalmgigsargegrslka
    aeiainsplleasmegaqgvlmsiaggsdlglfeineaaslvqdaahpdaniifgtvidd
    slgdevrvtviaagfdvsgpgrkpvmgetggahriesakagkltstlfepvdavsvplht
    ngatlsiggddddvdvppfmrr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rq7B (B:)
    nylavikvvgiggggvnavnrmieqglkgvefiaintdaqallmsdadvkldvgadpevg
    rkaaedakdeieellrgadmvfvtagegggtgtggapvvasiarklgaltvgvvtrpfsf
    egkrrsnqaengiaalrescdtlivipndrllqmgvslmdafrsadevllngvqgitdli
    ttpglinvdfadvkgimsgagtalmgigsargegrslkaaeiainsplleasmegaqgvl
    msiaggsdlglfeineaaslvqdaahpdaniifgtviddslgdevrvtviaagfd