PDB entry 1rq6

View 1rq6 on RCSB PDB site
Description: Solution structure of ribosomal protein S17E from Methanobacterium Thermoautotrophicum, Northeast Structural Genomics Consortium Target TT802 / Ontario Center for Structural Proteomics Target Mth0803
Class: translation
Keywords: alpha protein, Structural Genomics, Protein Structure Initiative, PSI, NESG, Northeast Structural Genomics Consortium
Deposited on 2003-12-04, released 2004-12-14
The last revision prior to the SCOP 1.73 freeze date was dated 2005-01-25, with a file datestamp of 2007-06-04.
Experiment type: NMR15
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 30S ribosomal protein S17e
    Species: Methanobacterium thermoautotrophicum
    Gene: RPS17E, MTH803
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1rq6a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rq6A (A:)
    mgnirtsfvkriakemiethpgkftddfdtnkklveefstvstkhlrnkiagyitriisq
    qk