PDB entry 1rq6

View 1rq6 on RCSB PDB site
Description: solution structure of ribosomal protein s17e from methanobacterium thermoautotrophicum, northeast structural genomics consortium target tt802 / ontario center for structural proteomics target mth0803
Deposited on 2003-12-04, released 2004-12-14
The last revision prior to the SCOP 1.71 freeze date was dated 2004-12-14, with a file datestamp of 2004-12-14.
Experiment type: NMR15
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1rq6a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rq6A (A:)
    mgnirtsfvkriakemiethpgkftddfdtnkklveefstvstkhlrnkiagyitriisq
    qk