PDB entry 1rq5

View 1rq5 on RCSB PDB site
Description: Structural Basis for the Exocellulase Activity of the Cellobiohydrolase CbhA from C. thermocellum
Class: hydrolase
Keywords: Cellobiohydrolase, CbhA, EXOCELLULASE, FAMILY 9
Deposited on 2003-12-04, released 2004-03-30
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.21
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cellobiohydrolase
    Species: Clostridium thermocellum [TaxId:1515]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q59325 (0-605)
      • engineered (587)
      • see remark 999 (606-607)
    Domains in SCOPe 2.06: d1rq5a1, d1rq5a2
  • Heterogens: CA, CTT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1rq5A (A:)
    ilpqpdvrvnqvgylpegkkvatvvcnstqpvkwqlknaagvvvlegytepkgldkdsqd
    yvhwldfsdfategigyyfelptvnsptnyshpfdirkdiytqmkydalaffyhkrsgip
    iempyaggeqwtrpaghigiepnkgdtnvptwpqddeyagipqknytkdvtggwydagdh
    gkyvvnggiavwtlmnmyerakirgldnwgpyrdggmnipeqnngypdildearweieff
    kkmqvtekedpsiagmvhhkihdfrwtalgmlphedpqprylrpvstaatlnfaatlaqs
    arlwkdydptfaadclekaeiawqaalkhpdiyaeytpgsggpgggpynddyvgdefywa
    acelyvttgkdeyknylmnsphylempakmgenggangednglwgcftwgttqglgtitl
    alvenglpatdiqkarnniakaadrwlenieeqgyrlpikqaederggypwgsnsfilnq
    mivmgyaydftgdskyldgmfdgisyllgrnamdqsyvtgygerplqnphdrfwtpqtsk
    rfpapppgiisggpnsrfedptinaavkkdtppqkcfidhtdswgtnqitvnwnapfawv
    tayldeqytd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rq5A (A:)
    ilpqpdvrvnqvgylpegkkvatvvcnstqpvkwqlknaagvvvlegytepkgldkdsqd
    yvhwldfsdfategigyyfelptvnsptnyshpfdirkdiytqmkydalaffyhkrsgip
    iempyaggeqwtrpaghigiepnkgdtnvptwpqddeyagipqknytkdvtggwydagdh
    gkyvvnggiavwtlmnmyerakirgldnwgpyrdggmnipeqnngypdildearweieff
    kkmqvtekedpsiagmvhhkihdfrwtalgmlphedpqprylrpvstaatlnfaatlaqs
    arlwkdydptfaadclekaeiawqaalkhpdiyaeytpgsggpgggpynddyvgdefywa
    acelyvttgkdeyknylmnsphylempakmggednglwgcftwgttqglgtitlalveng
    lpatdiqkarnniakaadrwlenieeqgyrlpikqaederggypwgsnsfilnqmivmgy
    aydftgdskyldgmfdgisyllgrnamdqsyvtgygerplqnphdrfwtpqtskrfpapp
    pgiisggpnsrfedptinaavkkdtppqkcfidhtdswgtnqitvnwnapfawvtaylde
    qy