PDB entry 1rq2

View 1rq2 on RCSB PDB site
Description: mycobacterium tuberculosis ftsz in complex with citrate
Class: cell cycle, signaling protein
Keywords: cell cycle, tubulin, gtpase, signaling protein
Deposited on 2003-12-04, released 2004-08-31
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.86 Å
R-factor: 0.189
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cell division protein ftsz
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: FTSZ, RV2150C, MT2209, MTCY270.18, MB2174C
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1rq2a1, d1rq2a2
  • Chain 'B':
    Compound: cell division protein ftsz
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: FTSZ, RV2150C, MT2209, MTCY270.18, MB2174C
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1rq2b1, d1rq2b2
  • Heterogens: CIT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1rq2A (A:)
    gshmtpphnylavikvvgiggggvnavnrmieqglkgvefiaintdaqallmsdadvkld
    vgrdstrglgagadpevgrkaaedakdeieellrgadmvfvtagegggtgtggapvvasi
    arklgaltvgvvtrpfsfegkrrsnqaengiaalrescdtlivipndrllqmgdaavslm
    dafrsadevllngvqgitdlittpglinvdfadvkgimsgagtalmgigsargegrslka
    aeiainsplleasmegaqgvlmsiaggsdlglfeineaaslvqdaahpdaniifgtvidd
    slgdevrvtviaagfdvsgpgrkpvmgetggahriesakagkltstlfepvdavsvplht
    ngatlsiggddddvdvppfmrr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rq2A (A:)
    lavikvvgiggggvnavnrmieqglkgvefiaintdaqallmsdadvkldvgrdstgadp
    evgrkaaedakdeieellrgadmvfvtagegggtgtggapvvasiarklgaltvgvvtrp
    fsfegkrrsnqaengiaalrescdtlivipndrllqmgdaavslmdafrsadevllngvq
    gitdlittpglinvdfadvkgimsgagtalmgigsargegrslkaaeiainsplleasme
    gaqgvlmsiaggsdlglfeineaaslvqdaahpdaniifgtviddslgdevrvtviaagf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1rq2B (B:)
    gshmtpphnylavikvvgiggggvnavnrmieqglkgvefiaintdaqallmsdadvkld
    vgrdstrglgagadpevgrkaaedakdeieellrgadmvfvtagegggtgtggapvvasi
    arklgaltvgvvtrpfsfegkrrsnqaengiaalrescdtlivipndrllqmgdaavslm
    dafrsadevllngvqgitdlittpglinvdfadvkgimsgagtalmgigsargegrslka
    aeiainsplleasmegaqgvlmsiaggsdlglfeineaaslvqdaahpdaniifgtvidd
    slgdevrvtviaagfdvsgpgrkpvmgetggahriesakagkltstlfepvdavsvplht
    ngatlsiggddddvdvppfmrr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rq2B (B:)
    lavikvvgiggggvnavnrmieqglkgvefiaintdaqallmsdadvkldvgadpevgrk
    aaedakdeieellrgadmvfvtagegggtgtggapvvasiarklgaltvgvvtrpfsfeg
    krrsnqaengiaalrescdtlivipndrllqmgvslmdafrsadevllngvqgitdlitt
    pglinvdfadvkgimsgagtalmgigsargegrslkaaeiainsplleasmegaqgvlms
    iaggsdlglfeineaaslvqdaahpdaniifgtviddslgdevrvtviaagfd