PDB entry 1rq1

View 1rq1 on RCSB PDB site
Description: Structure of Ero1p, Source of Disulfide Bonds for Oxidative Protein Folding in the Cell
Deposited on 2003-12-04, released 2004-06-08
The last revision prior to the SCOP 1.69 freeze date was dated 2004-06-08, with a file datestamp of 2004-06-08.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.206
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1rq1a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1rq1A (A:)
    gshhhhhhssglvprgsfnelnainenirddlsallksdffkyfrldlykqcsfwdandg
    lclnracsvdvvedwdtlpeywqpeilgsfnndtmkeaddsddeckfldqlcqtskkpvd
    iedtinycdvndfngknavlidltanperftgyggkqagqiwstiyqdncftigetgesl
    akdafyrlvsgfhasigthlskeylntktgkwepnldlfmarignfpdrvtnmyfnyavv
    akalwkiqpylpefsfcdlvnkeiknkmdnvisqldtkifnedlvfandlsltlkdefrs
    rfknvtkimdcvqcdrcrlwgkiqttgyatalkilfeindadeftkqhivgkltkyelia
    llqtfgrlsesiesvnmfekmygkrl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rq1A (A:)
    gsfnelnainenirddlsallksdffkyfrldlykqcsfwlclnracsvdvvedwdtlpe
    ywqpeilgsfnndtmkeaddsddeckfldqlcqtskkycdvndfngknavlidltanper
    ftgyggkqagqiwstiyqdncftigetgeslakdafyrlvsgfhasigthlskeylntkt
    gkwepnldlfmarignfpdrvtnmyfnyavvakalwkiqpylpefsfcdlvnkeiknkmd
    nvisqldtkifnedlvfandlsltlkdefrsrfnvtkimdcvqcdrcrlwgkiqttgyat
    alkilfeindadeftkqhivgkltkyeliallqtfgrlsesiesvnmfekmygkrl