PDB entry 1rq1

View 1rq1 on RCSB PDB site
Description: Structure of Ero1p, Source of Disulfide Bonds for Oxidative Protein Folding in the Cell
Class: oxidoreductase
Keywords: flavoenzyme, disulfide bonds, CXXCXXC, OXIDOREDUCTASE
Deposited on 2003-12-04, released 2004-06-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.206
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hypothetical 65.0 kDa protein in COX14-COS3 intergenic region precursor
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: YML130C, YM4987.05C
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q03103 (17-385)
      • cloning artifact (15-16)
    Domains in SCOPe 2.07: d1rq1a1, d1rq1a2
  • Heterogens: CD, NEN, FAD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1rq1A (A:)
    gshhhhhhssglvprgsfnelnainenirddlsallksdffkyfrldlykqcsfwdandg
    lclnracsvdvvedwdtlpeywqpeilgsfnndtmkeaddsddeckfldqlcqtskkpvd
    iedtinycdvndfngknavlidltanperftgyggkqagqiwstiyqdncftigetgesl
    akdafyrlvsgfhasigthlskeylntktgkwepnldlfmarignfpdrvtnmyfnyavv
    akalwkiqpylpefsfcdlvnkeiknkmdnvisqldtkifnedlvfandlsltlkdefrs
    rfknvtkimdcvqcdrcrlwgkiqttgyatalkilfeindadeftkqhivgkltkyelia
    llqtfgrlsesiesvnmfekmygkrl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rq1A (A:)
    gsfnelnainenirddlsallksdffkyfrldlykqcsfwlclnracsvdvvedwdtlpe
    ywqpeilgsfnndtmkeaddsddeckfldqlcqtskkycdvndfngknavlidltanper
    ftgyggkqagqiwstiyqdncftigetgeslakdafyrlvsgfhasigthlskeylntkt
    gkwepnldlfmarignfpdrvtnmyfnyavvakalwkiqpylpefsfcdlvnkeiknkmd
    nvisqldtkifnedlvfandlsltlkdefrsrfnvtkimdcvqcdrcrlwgkiqttgyat
    alkilfeindadeftkqhivgkltkyeliallqtfgrlsesiesvnmfekmygkrl