PDB entry 1rpy

View 1rpy on RCSB PDB site
Description: crystal structure of the dimeric sh2 domain of aps
Deposited on 2003-12-03, released 2003-12-23
The last revision prior to the SCOP 1.67 freeze date was dated 2003-12-23, with a file datestamp of 2003-12-23.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.228
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1rpya_
  • Chain 'B':
    Domains in SCOP 1.67: d1rpyb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1rpyA (A:)
    gshmelelsdypwfhgtlsrvkaaqlvlaggprshglfvirqsetrpgecvltfnfqgka
    khlrlslnghgqchvqhlwfqsvfdmlrhfhthpiplesggsaditlrsyvraq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rpyA (A:)
    elsdypwfhgtlsrvkaaqlvlaggprshglfvirqsetrpgecvltfnfqgkakhlrlh
    gqchvqhlwfqsvfdmlrhfht
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1rpyB (B:)
    gshmelelsdypwfhgtlsrvkaaqlvlaggprshglfvirqsetrpgecvltfnfqgka
    khlrlslnghgqchvqhlwfqsvfdmlrhfhthpiplesggsaditlrsyvraq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rpyB (B:)
    lsdypwfhgtlsrvkaaqlvlaggprshglfvirqsetrpgecvltfnfqgkakhlrlsg
    qchvqhlwfqsvfdmlrhfhthpipl