PDB entry 1rpy

View 1rpy on RCSB PDB site
Description: crystal structure of the dimeric sh2 domain of aps
Class: signaling protein
Keywords: adapter protein, sh2 domain, signaling protein
Deposited on 2003-12-03, released 2003-12-23
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.228
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: adaptor protein APS
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9Z200
      • modified residue (85)
    Domains in SCOPe 2.08: d1rpya_
  • Chain 'B':
    Compound: adaptor protein APS
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9Z200
      • modified residue (85)
    Domains in SCOPe 2.08: d1rpyb_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1rpyA (A:)
    gshmelelsdypwfhgtlsrvkaaqlvlaggprshglfvirqsetrpgecvltfnfqgka
    khlrlslnghgqchvqhlwfqsvfdmlrhfhthpiplesggsaditlrsyvraq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rpyA (A:)
    elsdypwfhgtlsrvkaaqlvlaggprshglfvirqsetrpgecvltfnfqgkakhlrlh
    gqchvqhlwfqsvfdmlrhfht
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1rpyB (B:)
    gshmelelsdypwfhgtlsrvkaaqlvlaggprshglfvirqsetrpgecvltfnfqgka
    khlrlslnghgqchvqhlwfqsvfdmlrhfhthpiplesggsaditlrsyvraq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rpyB (B:)
    lsdypwfhgtlsrvkaaqlvlaggprshglfvirqsetrpgecvltfnfqgkakhlrlsg
    qchvqhlwfqsvfdmlrhfhthpipl