PDB entry 1rpx

View 1rpx on RCSB PDB site
Description: d-ribulose-5-phosphate 3-epimerase from solanum tuberosum chloroplasts
Class: 3-epimerase
Keywords: 3-epimerase, chloroplast, calvin cycle, oxidative pentose phosphate pathway
Deposited on 1998-12-01, released 1999-04-07
The last revision prior to the SCOP 1.73 freeze date was dated 2005-03-01, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.174
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (ribulose-phosphate 3-epimerase)
    Species: Solanum tuberosum
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1rpxa_
  • Chain 'B':
    Compound: protein (ribulose-phosphate 3-epimerase)
    Species: Solanum tuberosum
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1rpxb_
  • Chain 'C':
    Compound: protein (ribulose-phosphate 3-epimerase)
    Species: Solanum tuberosum
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1rpxc_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rpxA (A:)
    srvdkfsksdiivspsilsanfsklgeqvkaieqagcdwihvdvmdgrfvpnitigplvv
    dslrpitdlpldvhlmivepdqrvpdfikagadivsvhceqsstihlhrtinqikslgak
    agvvlnpgtpltaieyvldavdlvlimsvnpgfggqsfiesqvkkisdlrkicaerglnp
    wievdggvgpknaykvieaganalvagsavfgapdyaeaikgiktskrpe
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rpxB (B:)
    srvdkfsksdiivspsilsanfsklgeqvkaieqagcdwihvdvmdgrfvpnitigplvv
    dslrpitdlpldvhlmivepdqrvpdfikagadivsvhceqsstihlhrtinqikslgak
    agvvlnpgtpltaieyvldavdlvlimsvnpgfggqsfiesqvkkisdlrkicaerglnp
    wievdggvgpknaykvieaganalvagsavfgapdyaeaikgiktskrpe
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rpxC (C:)
    srvdkfsksdiivspsilsanfsklgeqvkaieqagcdwihvdvmdgrfvpnitigplvv
    dslrpitdlpldvhlmivepdqrvpdfikagadivsvhceqsstihlhrtinqikslgak
    agvvlnpgtpltaieyvldavdlvlimsvnpgfggqsfiesqvkkisdlrkicaerglnp
    wievdggvgpknaykvieaganalvagsavfgapdyaeaikgiktskrpe