PDB entry 1rpx

View 1rpx on RCSB PDB site
Description: d-ribulose-5-phosphate 3-epimerase from solanum tuberosum chloroplasts
Deposited on 1998-12-01, released 1999-04-07
The last revision prior to the SCOP 1.71 freeze date was dated 1999-04-07, with a file datestamp of 1999-04-13.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.174
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1rpxa_
  • Chain 'B':
    Domains in SCOP 1.71: d1rpxb_
  • Chain 'C':
    Domains in SCOP 1.71: d1rpxc_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rpxA (A:)
    srvdkfsksdiivspsilsanfsklgeqvkaieqagcdwihvdvmdgrfvpnitigplvv
    dslrpitdlpldvhlmivepdqrvpdfikagadivsvhceqsstihlhrtinqikslgak
    agvvlnpgtpltaieyvldavdlvlimsvnpgfggqsfiesqvkkisdlrkicaerglnp
    wievdggvgpknaykvieaganalvagsavfgapdyaeaikgiktskrpe
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rpxB (B:)
    srvdkfsksdiivspsilsanfsklgeqvkaieqagcdwihvdvmdgrfvpnitigplvv
    dslrpitdlpldvhlmivepdqrvpdfikagadivsvhceqsstihlhrtinqikslgak
    agvvlnpgtpltaieyvldavdlvlimsvnpgfggqsfiesqvkkisdlrkicaerglnp
    wievdggvgpknaykvieaganalvagsavfgapdyaeaikgiktskrpe
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rpxC (C:)
    srvdkfsksdiivspsilsanfsklgeqvkaieqagcdwihvdvmdgrfvpnitigplvv
    dslrpitdlpldvhlmivepdqrvpdfikagadivsvhceqsstihlhrtinqikslgak
    agvvlnpgtpltaieyvldavdlvlimsvnpgfggqsfiesqvkkisdlrkicaerglnp
    wievdggvgpknaykvieaganalvagsavfgapdyaeaikgiktskrpe