PDB entry 1rpw

View 1rpw on RCSB PDB site
Description: Crystal Structure Of The Multidrug Binding Protein Qacr Bound To The Diamidine Hexamidine
Class: transcription
Keywords: QacR Hexamidine, TRANSCRIPTION
Deposited on 2003-12-03, released 2004-06-01
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-06-02, with a file datestamp of 2009-05-29.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.229
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Transcriptional regulator qacR
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: QacR, SAVP031
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A0N4
      • engineered (71)
      • engineered (140)
    Domains in SCOPe 2.08: d1rpwa1, d1rpwa2
  • Chain 'B':
    Compound: Transcriptional regulator qacR
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: QacR, SAVP031
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A0N4
      • engineered (71)
      • engineered (140)
    Domains in SCOPe 2.08: d1rpwb1, d1rpwb2
  • Chain 'C':
    Compound: Transcriptional regulator qacR
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: QacR, SAVP031
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A0N4
      • engineered (71)
      • engineered (140)
    Domains in SCOPe 2.08: d1rpwc1, d1rpwc2
  • Chain 'D':
    Compound: Transcriptional regulator qacR
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: QacR, SAVP031
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A0N4
      • engineered (71)
      • engineered (140)
    Domains in SCOPe 2.08: d1rpwd1, d1rpwd2
  • Heterogens: SO4, DID, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1rpwA (A:)
    mnlkdkilgvakelfikngynatttgeivklsesskgnlyyhfktkenlfleilnieesk
    wqeqwkkeqikaktnrekfylynelsltteyyyplqnaiiefyteyyktnsinekmnkle
    nkyidayhvifkegnlngewsindvnavskiaanavngivtftheqnineriklmnkfsq
    iflnglsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rpwA (A:)
    nlkdkilgvakelfikngynatttgeivklsesskgnlyyhfktkenlfleilnieeskw
    qeqwkkeqikaktnrekfylynelsltteyyyplqnaiiefyteyyktnsinekmnklen
    kyidayhvifkegnlngewsindvnavskiaanavngivtftheqnineriklmnkfsqi
    flngls
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1rpwB (B:)
    mnlkdkilgvakelfikngynatttgeivklsesskgnlyyhfktkenlfleilnieesk
    wqeqwkkeqikaktnrekfylynelsltteyyyplqnaiiefyteyyktnsinekmnkle
    nkyidayhvifkegnlngewsindvnavskiaanavngivtftheqnineriklmnkfsq
    iflnglsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rpwB (B:)
    nlkdkilgvakelfikngynatttgeivklsesskgnlyyhfktkenlfleilnieeskw
    qeqwkkeqikaktnrekfylynelsltteyyyplqnaiiefyteyyktnsinekmnklen
    kyidayhvifkegnlngewsindvnavskiaanavngivtftheqnineriklmnkfsqi
    flngls
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1rpwC (C:)
    mnlkdkilgvakelfikngynatttgeivklsesskgnlyyhfktkenlfleilnieesk
    wqeqwkkeqikaktnrekfylynelsltteyyyplqnaiiefyteyyktnsinekmnkle
    nkyidayhvifkegnlngewsindvnavskiaanavngivtftheqnineriklmnkfsq
    iflnglsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rpwC (C:)
    nlkdkilgvakelfikngynatttgeivklsesskgnlyyhfktkenlfleilnieeskw
    qeqwkkeqikaktnrekfylynelsltteyyyplqnaiiefyteyyktnsinekmnklen
    kyidayhvifkegnlngewsindvnavskiaanavngivtftheqnineriklmnkfsqi
    flngls
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1rpwD (D:)
    mnlkdkilgvakelfikngynatttgeivklsesskgnlyyhfktkenlfleilnieesk
    wqeqwkkeqikaktnrekfylynelsltteyyyplqnaiiefyteyyktnsinekmnkle
    nkyidayhvifkegnlngewsindvnavskiaanavngivtftheqnineriklmnkfsq
    iflnglsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rpwD (D:)
    nlkdkilgvakelfikngynatttgeivklsesskgnlyyhfktkenlfleilnieeskw
    qeqwkkeqikaktnrekfylynelsltteyyyplqnaiiefyteyyktnsinekmnklen
    kyidayhvifkegnlngewsindvnavskiaanavngivtftheqnineriklmnkfsqi
    flngls