PDB entry 1rpu

View 1rpu on RCSB PDB site
Description: crystal structure of cirv p19 bound to sirna
Deposited on 2003-12-03, released 2004-01-13
The last revision prior to the SCOP 1.67 freeze date was dated 2004-01-13, with a file datestamp of 2004-01-13.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.224
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1rpua_
  • Chain 'B':
    Domains in SCOP 1.67: d1rpub_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1rpuA (A:)
    meraiqgndtreqangerwdggsggitspfklpdespswtewrlyndetnsnqdnplgfk
    eswgfgkvvfkrylrydrteaslhrvlgswtgdsvnyaasrflganqvgctysirfrgvs
    vtisggsrtlqhlcemairskqellqltpvevesnvsrgcpegietfkkese
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rpuA (A:)
    ndtreqangerwdggsggitspfklpdespswtewrlyndenplgfkeswgfgkvvfkry
    lrydrteaslhrvlgswtgdsvnyaasrflganqvgctysirfrgvsvtisggsrtlqhl
    cemairskqellqltpvev
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1rpuB (B:)
    meraiqgndtreqangerwdggsggitspfklpdespswtewrlyndetnsnqdnplgfk
    eswgfgkvvfkrylrydrteaslhrvlgswtgdsvnyaasrflganqvgctysirfrgvs
    vtisggsrtlqhlcemairskqellqltpvevesnvsrgcpegietfkkese
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rpuB (B:)
    ndtreqangerwdggsggitspfklpdespswtewrlyndenplgfkeswgfgkvvfkry
    lrydrteaslhrvlgswtgdsvnyaasrflganqvgctysirfrgvsvtisggsrtlqhl
    cemairskqellqltp