PDB entry 1rpt

View 1rpt on RCSB PDB site
Description: crystal structures of rat acid phosphatase complexed with the transitions state analogs vanadate and molybdate: implications for the reaction mechanism
Class: hydrolase(phosphoric monoester)
Keywords: hydrolase(phosphoric monoester)
Deposited on 1993-11-29, released 1994-05-31
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-07-04.
Experiment type: XRAY
Resolution: 3 Å
R-factor: N/A
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: prostatic acid phosphatase
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P20646 (0-341)
      • conflict (96)
      • conflict (190-191)
      • conflict (256)
      • conflict (268-269)
      • conflict (292)
    Domains in SCOPe 2.08: d1rpta_
  • Heterogens: NAG, VO4

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1rptA (A:)
kelkfvtlvfrhgdrgpietfpndpikesswpqgfgqltkwgmgqhyelgsyirrrygrf
lnnsykhdqvyirstdvdrtlmsamtnlaalfppegnsiwnprllwqpipvhtvslsedr
llylpfrdcprfqelksetlkseeflkrlqpyksfidtlpslsgfedqdlfeiwsrlydp
lycesvhnftlptwatedamtklkelselsllslygihkqkeksrlqggvlvneilknmk
latqpqkarklimysahdttvsglqmaldvyngllppyaschimelyqdngghfvemyyr
netqnepypltlpgcthscplekfaelldpvipqdwatecmg