PDB entry 1rpq

View 1rpq on RCSB PDB site
Description: high affinity ige receptor (alpha chain) complexed with tight-binding e131 'zeta' peptide from phage display
Deposited on 2003-12-03, released 2004-07-20
The last revision prior to the SCOP 1.69 freeze date was dated 2004-07-20, with a file datestamp of 2004-07-20.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.294
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1rpqA (A:)
    vpqkpkvslnppwnrifkgenvtltcngnnffevsstkwfhngslseetnsslnivnakf
    edsgeykcqhqqvnesepvylevfsdwlllqasaevvmegqplflrchgwrnwdvykviy
    ykdgealkywyenhnisitnatvedsgtyyctgkvwqldyeseplnitvikaprek
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rpqA (A:)
    kpkvslnppwnrifkgenvtltcngnnvsstkwfhngslseetnsslnivnakfedsgey
    kcqhqqvnesepvylevfsdwlllqasaevvmegqplflrchgwrnwdvykviyykdgea
    lkywyenhnisitnatvedsgtyyctgkvwqldyeseplnitvik
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1rpqB (B:)
    vpqkpkvslnppwnrifkgenvtltcngnnffevsstkwfhngslseetnsslnivnakf
    edsgeykcqhqqvnesepvylevfsdwlllqasaevvmegqplflrchgwrnwdvykviy
    ykdgealkywyenhnisitnatvedsgtyyctgkvwqldyeseplnitvikaprek
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rpqB (B:)
    kpkvslnppwnrifkgenvtltcngnvsstkwfhngslseetnsslnivnakfedsgeyk
    cqhqqvnesepvylevfsdwlllqasaevvmegqplflrchgwrnwdvykviyykdgeal
    kywyenhnisitnatvedsgtyyctgkvwqldyeseplnitvik
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1rpqC (C:)
    vpqkpkvslnppwnrifkgenvtltcngnnffevsstkwfhngslseetnsslnivnakf
    edsgeykcqhqqvnesepvylevfsdwlllqasaevvmegqplflrchgwrnwdvykviy
    ykdgealkywyenhnisitnatvedsgtyyctgkvwqldyeseplnitvikaprek
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rpqC (C:)
    kpkvslnppwnrifkgenvtltcngnnfvsstkwfhngslseetnsslnivnakfedsge
    ykcqhqqvnesepvylevfsdwlllqasaevvmegqplflrchgwrnwdvykviyykdge
    alkywyenhnisitnatvedsgtyyctgkvwqldyeseplnitvik
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1rpqD (D:)
    vpqkpkvslnppwnrifkgenvtltcngnnffevsstkwfhngslseetnsslnivnakf
    edsgeykcqhqqvnesepvylevfsdwlllqasaevvmegqplflrchgwrnwdvykviy
    ykdgealkywyenhnisitnatvedsgtyyctgkvwqldyeseplnitvikaprek
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rpqD (D:)
    kpkvslnppwnrifkgenvtltcngnnffvsstkwfhngslseetnsslnivnakfedsg
    eykcqhqqvnesepvylevfsdwlllqasaevvmegqplflrchgwrnwdvykviyykdg
    ealkywyenhnisitnatvedsgtyyctgkvwqldyeseplnitvik