PDB entry 1rpn

View 1rpn on RCSB PDB site
Description: Crystal Structure of GDP-D-mannose 4,6-dehydratase in complexes with GDP and NADPH
Class: lyase
Keywords: short-chain dehydrogenase/reductase, Rossmann fold, LYASE
Deposited on 2003-12-03, released 2004-02-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: 0.174
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: GDP-mannose 4,6-dehydratase
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: GCA, PA5453
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1rpna_
  • Chain 'B':
    Compound: GDP-mannose 4,6-dehydratase
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: GCA, PA5453
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1rpnb_
  • Chain 'C':
    Compound: GDP-mannose 4,6-dehydratase
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: GCA, PA5453
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1rpnc_
  • Chain 'D':
    Compound: GDP-mannose 4,6-dehydratase
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: GCA, PA5453
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1rpnd_
  • Heterogens: NDP, GDP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1rpnA (A:)
    mrgshhhhhhgsmtrsalvtgitgqdgaylaklllekgyrvhglvarrssdtrwrlrelg
    iegdiqyedgdmadacsvqravikaqpqevynlaaqsfvgaswnqpvttgvvdglgvthl
    leairqfspetrfyqastsemfgliqaerqdentpfyprspygvaklyghwitvnyresf
    glhassgilfnhesplrgiefvtrkvtdavariklgkqqelrlgnvdakrdwgfagdyve
    amwlmlqqdkaddyvvatgvtttvrdmcqiafehvgldyrdflkidpaffrpaevdvllg
    npakaqrvlgwkprtsldelirmmveadlrrvsre
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rpnA (A:)
    rsalvtgitgqdgaylaklllekgyrvhglvarrssdtrwrlrelgiegdiqyedgdmad
    acsvqravikaqpqevynlaaqsfvgaswnqpvttgvvdglgvthlleairqfspetrfy
    qastsemfgliqaerqdentpfyprspygvaklyghwitvnyresfglhassgilfnhes
    plrgiefvtrkvtdavariklgkqqelrlgnvdakrdwgfagdyveamwlmlqqdkaddy
    vvatgvtttvrdmcqiafehvgldyrdflkidpaffrpaevdvllgnpakaqrvlgwkpr
    tsldelirmmveadlrrvsre
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1rpnB (B:)
    mrgshhhhhhgsmtrsalvtgitgqdgaylaklllekgyrvhglvarrssdtrwrlrelg
    iegdiqyedgdmadacsvqravikaqpqevynlaaqsfvgaswnqpvttgvvdglgvthl
    leairqfspetrfyqastsemfgliqaerqdentpfyprspygvaklyghwitvnyresf
    glhassgilfnhesplrgiefvtrkvtdavariklgkqqelrlgnvdakrdwgfagdyve
    amwlmlqqdkaddyvvatgvtttvrdmcqiafehvgldyrdflkidpaffrpaevdvllg
    npakaqrvlgwkprtsldelirmmveadlrrvsre
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rpnB (B:)
    rsalvtgitgqdgaylaklllekgyrvhglvarrssdtrwrlrelgiegdiqyedgdmad
    acsvqravikaqpqevynlaaqsfvgaswnqpvttgvvdglgvthlleairqfspetrfy
    qastsemfgliqaerqdentpfyprspygvaklyghwitvnyresfglhassgilfnhes
    plrgiefvtrkvtdavariklgkqqelrlgnvdakrdwgfagdyveamwlmlqqdkaddy
    vvatgvtttvrdmcqiafehvgldyrdflkidpaffrpaevdvllgnpakaqrvlgwkpr
    tsldelirmmveadlrrvsre
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1rpnC (C:)
    mrgshhhhhhgsmtrsalvtgitgqdgaylaklllekgyrvhglvarrssdtrwrlrelg
    iegdiqyedgdmadacsvqravikaqpqevynlaaqsfvgaswnqpvttgvvdglgvthl
    leairqfspetrfyqastsemfgliqaerqdentpfyprspygvaklyghwitvnyresf
    glhassgilfnhesplrgiefvtrkvtdavariklgkqqelrlgnvdakrdwgfagdyve
    amwlmlqqdkaddyvvatgvtttvrdmcqiafehvgldyrdflkidpaffrpaevdvllg
    npakaqrvlgwkprtsldelirmmveadlrrvsre
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rpnC (C:)
    trsalvtgitgqdgaylaklllekgyrvhglvarrssdtrwrlrelgiegdiqyedgdma
    dacsvqravikaqpqevynlaaqsfvgaswnqpvttgvvdglgvthlleairqfspetrf
    yqastsemfgliqaerqdentpfyprspygvaklyghwitvnyresfglhassgilfnhe
    splrgiefvtrkvtdavariklgkqqelrlgnvdakrdwgfagdyveamwlmlqqdkadd
    yvvatgvtttvrdmcqiafehvgldyrdflkidpaffrpaevdvllgnpakaqrvlgwkp
    rtsldelirmmveadlrrvsre
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1rpnD (D:)
    mrgshhhhhhgsmtrsalvtgitgqdgaylaklllekgyrvhglvarrssdtrwrlrelg
    iegdiqyedgdmadacsvqravikaqpqevynlaaqsfvgaswnqpvttgvvdglgvthl
    leairqfspetrfyqastsemfgliqaerqdentpfyprspygvaklyghwitvnyresf
    glhassgilfnhesplrgiefvtrkvtdavariklgkqqelrlgnvdakrdwgfagdyve
    amwlmlqqdkaddyvvatgvtttvrdmcqiafehvgldyrdflkidpaffrpaevdvllg
    npakaqrvlgwkprtsldelirmmveadlrrvsre
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rpnD (D:)
    trsalvtgitgqdgaylaklllekgyrvhglvarrssdtrwrlrelgiegdiqyedgdma
    dacsvqravikaqpqevynlaaqsfvgaswnqpvttgvvdglgvthlleairqfspetrf
    yqastsemfgliqaerqdentpfyprspygvaklyghwitvnyresfglhassgilfnhe
    splrgiefvtrkvtdavariklgkqqelrlgnvdakrdwgfagdyveamwlmlqqdkadd
    yvvatgvtttvrdmcqiafehvgldyrdflkidpaffrpaevdvllgnpakaqrvlgwkp
    rtsldelirmmveadlrrvsre