PDB entry 1rpk

View 1rpk on RCSB PDB site
Description: Crystal structure of barley alpha-amylase isozyme 1 (amy1) in complex with acarbose
Class: hydrolase
Keywords: ALPHA-AMYLASE, BARLEY, ISOZYME 1, BETA-ALPHA-BARREL, SUGAR TONGS BINDING SITE, ACARBOSE, Hydrolase
Deposited on 2003-12-03, released 2005-06-07
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-07-04.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Alpha-amylase type 1 isozyme
    Species: Hordeum vulgare [TaxId:4513]
    Gene: AMY1.1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00693 (0-End)
      • see remark 999 (283)
    Domains in SCOPe 2.08: d1rpka1, d1rpka2
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1rpkA (A:)
    hqvlfqgfnweswkqsggwynmmmgkvddiaaagvthvwlpppshsvsnegympgrlydi
    daskygnaaelksligalhgkgvqaiadivinhrcadykdsrgiycifeggtsdgrldwg
    phmicrddtkysdgtanldtgadfaaapdidhlndrvqrelkewllwlksdlgfdawrld
    fargyspemakvyidgtspslavaevwdnmatggdgkpnydqdahrqnlvnwvdkvggaa
    sagmvfdfttkgilnaavegelwrlidpqgkapgvmgwwpakavtfvdnhdtgstqamwp
    fpsdkvmqgyayilthpgipcifydhffnwgfkdqiaalvairkrngitatsalkilmhe
    gdayvaeidgkvvvkigsrydvgavipagfvtsahgndyavwekn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rpkA (A:)
    hqvlfqgfnweswkqsggwynmmmgkvddiaaagvthvwlpppshsvsnegympgrlydi
    daskygnaaelksligalhgkgvqaiadivinhrcadykdsrgiycifeggtsdgrldwg
    phmicrddtkysdgtanldtgadfaaapdidhlndrvqrelkewllwlksdlgfdawrld
    fargyspemakvyidgtspslavaevwdnmatggdgkpnydqdahrqnlvnwvdkvggaa
    sagmvfdfttkgilnaavegelwrlidpqgkapgvmgwwpakavtfvdnhdtgstqamwp
    fpsdkvmqgyayilthpgipcifydhffnwgfkdqiaalvairkrngitatsalkilmhe
    gdayvaeidgkvvvkigsrydvgavipagfvtsahgndyavwek