PDB entry 1rpj

View 1rpj on RCSB PDB site
Description: crystal structure of d-allose binding protein from escherichia coli
Deposited on 1999-02-04, released 1999-02-16
The last revision prior to the SCOP 1.57 freeze date was dated 1999-04-14, with a file datestamp of 1999-04-13.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.194
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.57: d1rpja_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rpjA (A:)
    aaeyavvlktlsnpfwvdmkkgiedeaktlgvsvdifaspsegdfqsqlqlfedlsnkny
    kgiafaplssvnlvmpvarawkkgiylvnldekidmdnlkkaggnveafvttdnvavgak
    gasfiidklgaeggevaiiegkagnasgearrngateafkkasqiklvasqpadwdrika
    ldvatnvlqrnpnikaiycandtmamgvaqavanagktgkvlvvgtdgipearkmveagq
    mtatvaqnpadigatglklmvdaeksgkvipldkapefklvdsilvtq