PDB entry 1rph

View 1rph on RCSB PDB site
Description: structures of rnase a complexed with 3'-cmp and d(cpa): active site conformation and conserved water molecules
Deposited on 1994-08-29, released 1994-12-20
The last revision prior to the SCOP 1.63 freeze date was dated 1994-12-20, with a file datestamp of 1995-01-05.
Experiment type: -
Resolution: 2.2 Å
R-factor: 0.158
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.63: d1rph__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rph_ (-)
    ketaaakferqhmdsstsaasssnycnqmmksrnltkdrckpvntfvhesladvqavcsq
    knvackngqtncyqsystmsitdcretgsskypncaykttqankhiivacegnpyvpvhf
    dasv