PDB entry 1rpf

View 1rpf on RCSB PDB site
Description: the structures of rnase complexed with 3'-cmp and d(cpa): active site conformation and conserved water molecules
Deposited on 1994-08-29, released 1994-12-20
The last revision prior to the SCOP 1.55 freeze date was dated 1994-12-20, with a file datestamp of 1995-01-05.
Experiment type: -
Resolution: 2.2 Å
R-factor: 0.155
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

• Chain ' ':
  Domains in SCOP 1.55: d1rpf__

PDB Chain Sequences:

• Chain ' ':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1rpf_ (-)
  ketaaakferqhmdsstsaasssnycnqmmksrnltkdrckpvntfvhesladvqavcsq
  knvackngqtncyqsystmsitdcretgsskypncaykttqankhiivacegnpyvpvhf
  dasv