PDB entry 1rpe

View 1rpe on RCSB PDB site
Description: the phage 434 or2/r1-69 complex at 2.5 angstroms resolution
Class: gene regulation/DNA
Keywords: protein-DNA complex, double helix, gene regulation/DNA complex
Deposited on 1993-03-24, released 1994-01-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.209
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA (5'-d(*ap*cp*ap*ap*ap*cp*ap*ap*gp*ap*tp*ap*cp*ap*tp*tp*g p*tp*ap*t)-3')
  • Chain 'B':
    Compound: DNA (5'-d(*tp*ap*tp*ap*cp*ap*ap*tp*gp*tp*ap*tp*cp*tp*tp*gp*t p*tp*tp*g)-3')
  • Chain 'L':
    Compound: protein (434 repressor)
    Species: Phage 434 [TaxId:10712]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1rpel_
  • Chain 'R':
    Compound: protein (434 repressor)
    Species: Phage 434 [TaxId:10712]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1rper_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >1rpeL (L:)
    sissrvkskriqlglnqaelaqkvgttqqsieqlengktkrprflpelasalgvsvdwll
    ngtsdsnvr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rpeL (L:)
    sissrvkskriqlglnqaelaqkvgttqqsieqlengktkrprflpelasalgvsvdwll
    ngt
    

  • Chain 'R':
    Sequence, based on SEQRES records: (download)
    >1rpeR (R:)
    sissrvkskriqlglnqaelaqkvgttqqsieqlengktkrprflpelasalgvsvdwll
    ngtsdsnvr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rpeR (R:)
    sissrvkskriqlglnqaelaqkvgttqqsieqlengktkrprflpelasalgvsvdwll
    ngt