PDB entry 1rp3

View 1rp3 on RCSB PDB site
Description: Cocrystal structure of the flagellar sigma/anti-sigma complex, Sigma-28/FlgM
Class: transcription
Keywords: transcription, sigma factor
Deposited on 2003-12-02, released 2004-04-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.242
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: RNA polymerase sigma factor SIGMA-28 (FliA)
    Species: Aquifex aeolicus [TaxId:63363]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O67268 (3-End)
      • cloning artifact (2)
    Domains in SCOPe 2.07: d1rp3a1, d1rp3a2, d1rp3a3, d1rp3a4
  • Chain 'B':
    Compound: anti sigma factor FlgM
    Species: Aquifex aeolicus [TaxId:63363]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1rp3b_
  • Chain 'C':
    Compound: RNA polymerase sigma factor SIGMA-28 (FliA)
    Species: Aquifex aeolicus [TaxId:63363]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1rp3c1, d1rp3c2, d1rp3c3
  • Chain 'D':
    Compound: anti sigma factor FlgM
    Species: Aquifex aeolicus [TaxId:63363]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1rp3d_
  • Chain 'E':
    Compound: RNA polymerase sigma factor SIGMA-28 (FliA)
    Species: Aquifex aeolicus [TaxId:63363]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1rp3e1, d1rp3e2, d1rp3e3
  • Chain 'F':
    Compound: anti sigma factor FlgM
    Species: Aquifex aeolicus [TaxId:63363]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1rp3f_
  • Chain 'G':
    Compound: RNA polymerase sigma factor SIGMA-28 (FliA)
    Species: Aquifex aeolicus [TaxId:63363]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1rp3g1, d1rp3g2, d1rp3g3
  • Chain 'H':
    Compound: anti sigma factor FlgM
    Species: Aquifex aeolicus [TaxId:63363]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1rp3h_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1rp3A (A:)
    gshmknpysnqiereelilkylplvkaiatnikkhlpedvdirdlisygviglikavdnl
    stenpkraeayiklrikgaiydylrsldfgsrqvrekerrikevveklkeklgreptdee
    vakelgisteelfktldkinfsyilsleevfrdfardyselipsstnveeevikreltek
    vkeavsklpereklviqlifyeelpakevakiletsvsrvsqlkakalerlremlsnpl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rp3A (A:)
    hmknpysnqiereelilkylplvkaiatnikkhlpedvdirdlisygviglikavdnlst
    enpkraeayiklrikgaiydylrsldfgsrqvrekerrikevveklkeklgreptdeeva
    kelgisteelfktldkinfsyilsleevfrdfardyselipsstnveeevikreltekvk
    eavsklpereklviqlifyeelpakevakiletsvsrvsqlkakalerlremlsn
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1rp3B (B:)
    mvnrielsrligllletekrknteqkesgtnkiedkvtlskiaqelskndveekdlekkv
    kelkekiekgeyevsdekvvkgliefft
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rp3B (B:)
    vnrielsrligllletsgtnkiedkvtlskiaqelskndveekdlekkvkelkekiekge
    yevsdekvvkgliefft
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1rp3C (C:)
    gshmknpysnqiereelilkylplvkaiatnikkhlpedvdirdlisygviglikavdnl
    stenpkraeayiklrikgaiydylrsldfgsrqvrekerrikevveklkeklgreptdee
    vakelgisteelfktldkinfsyilsleevfrdfardyselipsstnveeevikreltek
    vkeavsklpereklviqlifyeelpakevakiletsvsrvsqlkakalerlremlsnpl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rp3C (C:)
    knpysnqiereelilkylplvkaiatnikkhlpedvdirdlisygviglikavdnlsten
    pkraeayiklrikgaiydylrsldfgsrqvrekerrikevveklkeklgreptdeevake
    lgisteelfktldkinfsyilsleevfrdfardyselipsstnveeevikreltekvkea
    vsklpereklviqlifyeelpakevakiletsvsrvsqlkakalerlremlsnp
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1rp3D (D:)
    mvnrielsrligllletekrknteqkesgtnkiedkvtlskiaqelskndveekdlekkv
    kelkekiekgeyevsdekvvkgliefft
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rp3D (D:)
    nrielsrligllletedkvtlskiaqelskndveekdlekkvkelkekiekgeyevsdek
    vvkgliefft
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1rp3E (E:)
    gshmknpysnqiereelilkylplvkaiatnikkhlpedvdirdlisygviglikavdnl
    stenpkraeayiklrikgaiydylrsldfgsrqvrekerrikevveklkeklgreptdee
    vakelgisteelfktldkinfsyilsleevfrdfardyselipsstnveeevikreltek
    vkeavsklpereklviqlifyeelpakevakiletsvsrvsqlkakalerlremlsnpl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rp3E (E:)
    knpysnqiereelilkylplvkaiatnikkhlpedvdirdlisygviglikavdnlsten
    pkraeayiklrikgaiydylrsldfgsrqvrekerrikevveklkeklgreptdeevake
    lgisteelfktldkinfsyilsleevfrdfardyselipsstnveeevikreltekvkea
    vsklpereklviqlifyeelpakevakiletsvsrvsqlkakalerlremlsnpl
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1rp3F (F:)
    mvnrielsrligllletekrknteqkesgtnkiedkvtlskiaqelskndveekdlekkv
    kelkekiekgeyevsdekvvkgliefft
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rp3F (F:)
    rielsrligllletdkvtlskiaqelsknddlekkvkelkekiekgeyevsdekvvkgli
    efft
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1rp3G (G:)
    gshmknpysnqiereelilkylplvkaiatnikkhlpedvdirdlisygviglikavdnl
    stenpkraeayiklrikgaiydylrsldfgsrqvrekerrikevveklkeklgreptdee
    vakelgisteelfktldkinfsyilsleevfrdfardyselipsstnveeevikreltek
    vkeavsklpereklviqlifyeelpakevakiletsvsrvsqlkakalerlremlsnpl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rp3G (G:)
    mknpysnqiereelilkylplvkaiatnikkhlpedvdirdlisygviglikavdnlste
    npkraeayiklrikgaiydylrsldfgsrqvrekerrikevveklkeklgreptdeevak
    elgisteelfktldkinfsyilsleevfrdfardyseevikreltekvkeavsklperek
    lviqlifyeelpakevakiletsvsrvsqlkakalerlremlsnpl
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1rp3H (H:)
    mvnrielsrligllletekrknteqkesgtnkiedkvtlskiaqelskndveekdlekkv
    kelkekiekgeyevsdekvvkgliefft
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rp3H (H:)
    mvnrielsrligllletekrkdkvtlskiaqelskndlekkvkelkekiekgeyevsdek
    vvkgliefft