PDB entry 1rp1

View 1rp1 on RCSB PDB site
Description: dog pancreatic lipase related protein 1
Deposited on 1998-04-02, released 1998-06-17
The last revision prior to the SCOP 1.55 freeze date was dated 1998-06-17, with a file datestamp of 1998-06-17.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.195
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rp1_ (-)
    kevcyeqigcfsdaepwagtairplkvlpwsperigtrfllytnknpnnfqtllpsdpst
    igasnfqtdkktrfiihgfidkgeenwlldmcknmfkveevncicvdwkkgsqtsytqaa
    nnvrvvgaqvaqmlsmlsanysyspsqvqlighslgahvageagsrtpglgritgldpve
    asfqgtpeevrldptdadfvdvihtdaaplipflgfgtsqqmghldffpnggeempgckk
    nalsqivdldgiwegtrdfvacnhlrsykyysesilnpdgfasypcasyrafesnkcfpc
    pdqgcpqmghyadkfaqkyflntgdssnfarwrygvsitlsgkratgqakvalfgskgnt
    hqfnifkgilkpgsthsnefdakldvgtiekvkflwnnnnptfpkvgaakitvqkgeekt
    vhsfcsestvredvlltltpc