PDB entry 1roz

View 1roz on RCSB PDB site
Description: Deoxyhypusine synthase holoenzyme in its low ionic strength, high pH crystal form
Class: transferase
Keywords: Rossmann Fold, NAD cofactor, deoxyhypusine, hypusine, spermidine, transferase
Deposited on 2003-12-02, released 2004-07-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-11-12, with a file datestamp of 2014-11-07.
Experiment type: XRAY
Resolution: 2.21 Å
R-factor: 0.178
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: deoxyhypusine synthase
    Species: Homo sapiens [TaxId:9606]
    Gene: DHPS, DS
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1roza_
  • Chain 'B':
    Compound: deoxyhypusine synthase
    Species: Homo sapiens [TaxId:9606]
    Gene: DHPS, DS
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1rozb_
  • Heterogens: NAD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1rozA (A:)
    megslereapagalaavlkhsstlppestqvrgydfnrgvnyralleafgttgfqatnfg
    ravqqvnamiekkleplsqdedqhadltqsrrpltsctiflgytsnlissgiretirylv
    qhnmvdvlvttaggveedlikclaptylgefslrgkelrenginrignllvpnenyckfe
    dwlmpildqmvmeqntegvkwtpskmiarlgkeinnpesvyywaqknhipvfspaltdgs
    lgdmiffhsyknpglvldivedlrlintqaifakctgmiilgggvvkhhiananlmrnga
    dyavyintaqefdgsdsgarpdeavswgkirvdaqpvkvyadaslvfpllvaetfaqkmd
    afmhekned
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rozA (A:)
    stqvrgydfnrgvnyralleafgttgfqatnfgravqqvnamiekkleplsqdedqhadl
    tqsrrpltsctiflgytsnlissgiretirylvqhnmvdvlvttaggveedlikclapty
    lgefslrgkelrenginrignllvpnenyckfedwlmpildqmvmeqntegvkwtpskmi
    arlgkeinnpesvyywaqknhipvfspaltdgslgdmiffhsyknpglvldivedlrlin
    tqaifakctgmiilgggvvkhhiananlmrngadyavyintaqefdgsdsgarpdeavsw
    gkirvdaqpvkvyadaslvfpllvaetfaqkmdafm
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1rozB (B:)
    megslereapagalaavlkhsstlppestqvrgydfnrgvnyralleafgttgfqatnfg
    ravqqvnamiekkleplsqdedqhadltqsrrpltsctiflgytsnlissgiretirylv
    qhnmvdvlvttaggveedlikclaptylgefslrgkelrenginrignllvpnenyckfe
    dwlmpildqmvmeqntegvkwtpskmiarlgkeinnpesvyywaqknhipvfspaltdgs
    lgdmiffhsyknpglvldivedlrlintqaifakctgmiilgggvvkhhiananlmrnga
    dyavyintaqefdgsdsgarpdeavswgkirvdaqpvkvyadaslvfpllvaetfaqkmd
    afmhekned
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rozB (B:)
    stqvrgydfnrgvnyralleafgttgfqatnfgravqqvnamiekkleplpltsctiflg
    ytsnlissgiretirylvqhnmvdvlvttaggveedlikclaptylgefslrgkelreng
    inrignllvpnenyckfedwlmpildqmvmeqntegvkwtpskmiarlgkeinnpesvyy
    waqknhipvfspaltdgslgdmiffhsyknpglvldivedlrlintqaifakctgmiilg
    ggvvkhhiananlmrngadyavyintaqefdgsdsgarpdeavswgkirvdaqpvkvyad
    aslvfpllvaetfaqkmdafm