PDB entry 1row

View 1row on RCSB PDB site
Description: Structure of SSP-19, an MSP-domain protein like family member in Caenorhabditis elegans
Class: structural protein
Keywords: BETA BARREL, Structural Genomics, PSI, Protein Structure Initiative, Southeast Collaboratory for Structural Genomics, SECSG, STRUCTURAL PROTEIN
Deposited on 2003-12-02, released 2003-12-23
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-19.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.225
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: MSP-domain protein like family member
    Species: Caenorhabditis elegans [TaxId:6239]
    Gene: SSP-19
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1rowa_
  • Chain 'B':
    Compound: MSP-domain protein like family member
    Species: Caenorhabditis elegans [TaxId:6239]
    Gene: SSP-19
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1rowb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1rowA (A:)
    msltadppactvpaagvssthklvnggaekivfkikssnnneyriapvfgfvdpsgskdv
    vitrtagapkedklvvhfasapadatdaqaafvavapagtvtipmsata
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rowA (A:)
    ltadppactvpaagvssthklvnggaekivfkikssnnneyriapvfgfvdpsgskdvvi
    trtagapkedklvvhfasapadatdaqaafvavapagtvtipmsata
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1rowB (B:)
    msltadppactvpaagvssthklvnggaekivfkikssnnneyriapvfgfvdpsgskdv
    vitrtagapkedklvvhfasapadatdaqaafvavapagtvtipmsata
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rowB (B:)
    ltadppactvpaagvssthklvnggaekivfkikssnnneyriapvfgfvdpsgskdvvi
    trtagapkedklvvhfasapadatdaqaafvavapagtvtipmsata