PDB entry 1row

View 1row on RCSB PDB site
Description: structure of ssp-19, an msp-domain protein like family member in caenorhabditis elegans
Deposited on 2003-12-02, released 2003-12-23
The last revision prior to the SCOP 1.67 freeze date was dated 2004-03-23, with a file datestamp of 2004-03-23.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.225
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1rowa_
  • Chain 'B':
    Domains in SCOP 1.67: d1rowb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1rowA (A:)
    msltadppactvpaagvssthklvnggaekivfkikssnnneyriapvfgfvdpsgskdv
    vitrtagapkedklvvhfasapadatdaqaafvavapagtvtipmsata
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rowA (A:)
    ltadppactvpaagvssthklvnggaekivfkikssnnneyriapvfgfvdpsgskdvvi
    trtagapkedklvvhfasapadatdaqaafvavapagtvtipmsata
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1rowB (B:)
    msltadppactvpaagvssthklvnggaekivfkikssnnneyriapvfgfvdpsgskdv
    vitrtagapkedklvvhfasapadatdaqaafvavapagtvtipmsata
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rowB (B:)
    ltadppactvpaagvssthklvnggaekivfkikssnnneyriapvfgfvdpsgskdvvi
    trtagapkedklvvhfasapadatdaqaafvavapagtvtipmsata