PDB entry 1rou

View 1rou on RCSB PDB site
Description: structure of fkbp59-I, the n-terminal domain of a 59 kda fk506-binding protein, nmr, 22 structures
Class: rotamase (isomerase)
Keywords: rotamase (isomerase), domain I (n-term) of a 59 kda, fk506-binding protein, peptidyl prolyl cis-trans isomerase
Deposited on 1996-06-14, released 1996-12-07
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: fkbp59-I
    Species: Oryctolagus cuniculus [TaxId:9986]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1roua_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1rouA (A:)
    eemdikaaesgaqsaplplegvdispkqdegvlkvikregtgtetpmigdrvfvhytgwl
    ldgtkfdssldrkdkfsfdlgkgevikawdiavatmkvgelcritckpeyaygsagsppk
    ippnatlvfevelfefkgedltddedgvp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rouA (A:)
    gvdispkqdegvlkvikregtgtetpmigdrvfvhytgwlldgtkfdssldrkdkfsfdl
    gkgevikawdiavatmkvgelcritckpeyaygsagsppkippnatlvfevelfefkg