PDB entry 1rof

View 1rof on RCSB PDB site
Description: nmr study of 4fe-4s ferredoxin of thermatoga maritima
Deposited on 1995-11-24, released 1996-06-10
The last revision prior to the SCOP 1.55 freeze date was dated 2001-01-10, with a file datestamp of 2001-01-10.
Experiment type: NMR10
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.55: d1rof__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rof_ (-)
    mkvrvdadacigcgvcenlcpdvfqlgddgkakvlqpetdlpcakdaadscptgaisvee