PDB entry 1rof

View 1rof on RCSB PDB site
Description: nmr study of 4fe-4s ferredoxin of thermatoga maritima
Class: electron transport
Keywords: electron transport, iron-sulfur
Deposited on 1995-11-24, released 1996-06-10
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-03-24, with a file datestamp of 2009-03-20.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ferredoxin
    Species: Thermotoga maritima [TaxId:2336]
    Gene: POTENTIAL
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1rofa_
  • Heterogens: SF4

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rofA (A:)
    mkvrvdadacigcgvcenlcpdvfqlgddgkakvlqpetdlpcakdaadscptgaisvee