PDB entry 1rod

View 1rod on RCSB PDB site
Description: chimeric protein of interleukin 8 and human melanoma growth stimulating activity protein, nmr
Deposited on 1995-11-24, released 1996-06-10
The last revision prior to the SCOP 1.63 freeze date was dated 1996-06-10, with a file datestamp of 1996-06-11.
Experiment type: NMR8
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.63: d1roda_
  • Chain 'B':
    Domains in SCOP 1.63: d1rodb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rodA (A:)
    sakelrcqciktyskpfhpkfikelrviesgphcanteiivklsdgrelcldpaspivkk
    iiekmlnsdksn
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rodB (B:)
    sakelrcqciktyskpfhpkfikelrviesgphcanteiivklsdgrelcldpaspivkk
    iiekmlnsdksn