PDB entry 1rod

View 1rod on RCSB PDB site
Description: chimeric protein of interleukin 8 and human melanoma growth stimulating activity protein, nmr
Class: chemokine
Keywords: cytokine, chemotaxis, inflammatory response, chemokine
Deposited on 1995-11-24, released 1996-06-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: chimeric protein of interleukin 8 and human melanoma growth stimulating activity protein
    Species: Homo sapiens [TaxId:9606]
    Gene: POTENTIAL
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1roda_
  • Chain 'B':
    Compound: chimeric protein of interleukin 8 and human melanoma growth stimulating activity protein
    Species: Homo sapiens [TaxId:9606]
    Gene: POTENTIAL
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1rodb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rodA (A:)
    sakelrcqciktyskpfhpkfikelrviesgphcanteiivklsdgrelcldpaspivkk
    iiekmlnsdksn
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rodB (B:)
    sakelrcqciktyskpfhpkfikelrviesgphcanteiivklsdgrelcldpaspivkk
    iiekmlnsdksn