PDB entry 1roc

View 1roc on RCSB PDB site
Description: Crystal structure of the histone deposition protein Asf1
Class: replication, chaperone
Keywords: beta-sandwich
Deposited on 2003-12-02, released 2003-12-23
The last revision prior to the SCOP 1.75 freeze date was dated 2003-12-23, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.2
AEROSPACI score: 0.71 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Anti-silencing protein 1
  Species: Saccharomyces cerevisiae
  Gene: ASF1, YJL115W, J0755
  Database cross-references and differences (RAF-indexed):
  • Uniprot P32447 (2-154)
    • cloning artifact (0-1)
  Domains in SCOP 1.75: d1roca_
• Heterogens: BR, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1rocA (A:)
  gasivsllgikvlnnpakftdpyefeitfecleslkhdlewkltyvgssrsldhdqelds
  ilvgpvpvgvnkfvfsadppsaelipaselvsvtvillscsydgrefvrvgyyvnneyde
  eelrenppakvqvdhivrnilaekprvtrfnivwd