PDB entry 1roc

View 1roc on RCSB PDB site
Description: Crystal structure of the histone deposition protein Asf1
Deposited on 2003-12-02, released 2003-12-23
The last revision prior to the SCOP 1.69 freeze date was dated 2003-12-23, with a file datestamp of 2003-12-23.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.2
AEROSPACI score: 0.6 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1roca_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rocA (A:)
    gasivsllgikvlnnpakftdpyefeitfecleslkhdlewkltyvgssrsldhdqelds
    ilvgpvpvgvnkfvfsadppsaelipaselvsvtvillscsydgrefvrvgyyvnneyde
    eelrenppakvqvdhivrnilaekprvtrfnivwd